StarFunc result for job id Q6STE5

User Input

>input (483 residues)
MAADEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGL
APAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRRKMADKILPQRIRELVPESQ
AYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIA
SWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQV
KRPGDLSVRCTLLLMLDYQPPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSH
DKEYINGDKYFQQIFDCPRLKFSEIPQRLTALLLPPDPIVINHVISVDPSDQKKTACYDI
DVEVEEPLKGQMSSFLLSTANQQEISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYV
QDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVV
RNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P9Z1	0.924	0.924	2.614E-86	483	0.998	0.998	Q6P9Z1.pdb.gz	SMRD3_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Mus musculus OX=10090 GN=Smarcd3 PE=1 SV=2
2	AFDB:B2KL77	0.779	0.790	1.453E-76	476	0.874	0.887	B2KL77.pdb.gz	B2KL77_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Danio rerio OX=7955 GN=smarcd3b PE=1 SV=1
3	AFDB:F6NVB1	0.792	0.750	4.728E-74	510	0.836	0.792	F6NVB1.pdb.gz
4	AFDB:Q92925	0.782	0.712	2.726E-68	531	0.689	0.627	Q92925.pdb.gz	SMRD2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=3
5	AFDB:D3ZBS9	0.783	0.735	2.600E-66	515	0.714	0.670	D3ZBS9.pdb.gz	D3ZBS9_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcd1 PE=3 SV=2
6	AFDB:A0A1L1QZS5	0.699	0.810	1.160E-64	413	0.718	0.840	A0A1L1QZS5.pdb.gz
7	AFDB:Q9VYG2	0.771	0.724	1.215E-61	515	0.617	0.579	Q9VYG2.pdb.gz	BAP60_DROME Brahma-associated protein of 60 kDa OS=Drosophila melanogaster OX=7227 GN=Bap60 PE=1 SV=1
8	AFDB:Q09646	0.781	0.843	3.854E-53	446	0.501	0.543	Q09646.pdb.gz	SWIC1_CAEEL SWI/SNF chromatin-remodeling accessory subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ham-3 PE=1 SV=1
9	AFDB:O02101	0.750	0.804	7.674E-50	449	0.437	0.470	O02101.pdb.gz	SWIC2_CAEEL SWI/SNF chromatin-remodeling accessory subunit 2 OS=Caenorhabditis elegans OX=6239 GN=swsn-2.2 PE=1 SV=2
10	AFDB:Q9FMT4	0.674	0.615	6.423E-40	534	0.325	0.294	Q9FMT4.pdb.gz	SNF12_ARATH SWI/SNF complex component SNF12 homolog OS=Arabidopsis thaliana OX=3702 GN=At5g14170 PE=1 SV=1
11	PDB:7vdvY	0.396	0.756	3.528E-23	245	0.395	0.780	7vdvY.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
12	PDB:7egmH	0.408	0.488	5.123E-19	388	0.193	0.240	7egmH.pdb.gz
13	PDB:6v8oM	0.245	0.354	1.743E-8	310	0.101	0.158	6v8oM.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
14	PDB:6k15I	0.236	0.424	1.042E-6	244	0.075	0.148	6k15I.pdb.gz	Structure of the RSC complex bound to the nucleosome.
15	PDB:6uxvH	0.284	0.482	4.234E-6	257	0.079	0.148	6uxvH.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
16	PDB:5svan	0.183	0.370	1.331E-4	200	0.054	0.130	5svan.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:6tdaO	0.209	0.429	5.409E-4	212	0.066	0.151	6tdaO.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
18	PDB:7kzpQ	0.122	0.086	1.512E-2	754	0.133	0.085	7kzpQ.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
19	PDB:5xbtA	0.083	0.134	3.852E-2	271	0.043	0.077	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
20	PDB:3jcmN	0.104	0.037	7.326E-2	1686	0.048	0.014	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N8Z9	0.0	940	470	0.946	0.972	A0A090N8Z9_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Homo sapiens OX=9606 GN=SMARCD3 PE=3 SV=1
2	A0A8I5ZQQ2	0.0	991	483	0.996	0.996	A0A8I5ZQQ2_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Rattus norvegicus OX=10116 GN=Smarcd3 PE=3 SV=1
3	A0A8I6A286	0.0	937	461	0.942	0.987	A0A8I6A286_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Rattus norvegicus OX=10116 GN=Smarcd3 PE=3 SV=1
4	A0A8I6AJE1	0.0	627	474	0.646	0.658	A0A8I6AJE1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcd1 PE=3 SV=1
5	B2KL77	0.0	842	476	0.878	0.891	B2KL77_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Danio rerio OX=7955 GN=smarcd3b PE=1 SV=1
6	B9EGA3	0.0	679	494	0.694	0.678	B9EGA3_HUMAN SMARCD2 protein OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=1
7	D3ZBS9	0.0	681	520	0.683	0.635	D3ZBS9_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcd1 PE=3 SV=2
8	E7EYW7	0.0	649	501	0.654	0.631	E7EYW7_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 isoform X1 OS=Danio rerio OX=7955 GN=smarcd2 PE=3 SV=1
9	J3KMX2	0.0	674	456	0.683	0.724	J3KMX2_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=1
10	Q5U3Y2	0.0	936	470	0.942	0.968	Q5U3Y2_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Rattus norvegicus OX=10116 GN=Smarcd3 PE=3 SV=1
11	Q61466	0.0	708	515	0.710	0.666	SMRD1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Mus musculus OX=10090 GN=Smarcd1 PE=1 SV=3
12	Q6P9Z1	0.0	993	483	0.998	0.998	SMRD3_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Mus musculus OX=10090 GN=Smarcd3 PE=1 SV=2
13	Q6STE5	0.0	994	483	1.000	1.000	SMRD3_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Homo sapiens OX=9606 GN=SMARCD3 PE=1 SV=1
14	Q802C8	0.0	703	510	0.714	0.676	Q802C8_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Danio rerio OX=7955 GN=wu:fa10h07 PE=1 SV=1
15	Q92925	0.0	679	531	0.694	0.631	SMRD2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=3
16	Q96GM5	0.0	708	515	0.710	0.666	SMRD1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=2
17	Q9VYG2	0.0	587	515	0.613	0.575	BAP60_DROME Brahma-associated protein of 60 kDa OS=Drosophila melanogaster OX=7227 GN=Bap60 PE=1 SV=1
18	Q09646	2.28e-161	466	446	0.505	0.547	SWIC1_CAEEL SWI/SNF chromatin-remodeling accessory subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ham-3 PE=1 SV=1
19	O02101	4.73e-136	401	449	0.441	0.474	SWIC2_CAEEL SWI/SNF chromatin-remodeling accessory subunit 2 OS=Caenorhabditis elegans OX=6239 GN=swsn-2.2 PE=1 SV=2
20	F8VZ70	4.71e-101	306	278	0.344	0.597	F8VZ70_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17669 DUF5529	1.7e+02	13.3	Family of unknown function (DUF5529)
2	PF02201 SWIB	1.9e-17	74.2	SWIB/MDM2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 51337.XP_004669626.1

Rank	PPI partner	STRING score	Description
1	51337.XP_004667521.1	0.998	Transcription activator BRG1 isoform X1
2	51337.XP_004655489.1	0.996	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 isoform X1
3	51337.XP_004668594.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 4 Proteins
4	51337.XP_004671269.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 3 Proteins
5	51337.XP_004650031.1	0.993	SWI/SNF complex subunit SMARCC2
6	51337.XP_004670995.1	0.991	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 isoform X1
7	51337.XP_004652131.1	0.990	Actin-like protein 6A
8	51337.XP_004653212.1	0.990	Upstream in-frame stop codon
9	51337.XP_004666364.1	0.989	Actin-like protein 6B
10	51337.XP_004649480.1	0.987	Zinc finger protein DPF3 isoform X1
11	51337.XP_004651129.1	0.987	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 5 Proteins
12	51337.XP_004662014.1	0.987	SWI/SNF complex subunit SMARCC1
13	51337.XP_004664852.1	0.985	Bromodomain-containing protein 7
14	51337.XP_004651338.1	0.982	AT-rich interactive domain-containing protein 1B
15	51337.XP_004649879.1	0.981	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 isoform X1
16	51337.XP_004661342.1	0.981	Protein polybromo-1 isoform X1
17	51337.XP_004654899.1	0.974	Protein SSXT isoform X1
18	51337.XP_004659961.1	0.974	Zinc finger protein neuro-d4 isoform X1
19	51337.XP_004655129.1	0.964	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 isoform X1
20	51337.XP_004666150.1	0.963	Bromodomain-containing protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.999	chromatin binding
GO:0097159	0.591	organic cyclic compound binding
GO:1901363	0.586	heterocyclic compound binding
GO:0003676	0.546	nucleic acid binding
GO:0003677	0.544	DNA binding
GO:0140110	0.461	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.996	positive regulation of cellular process
GO:0009987	0.984	cellular process
GO:0050793	0.973	regulation of developmental process
GO:1901987	0.886	regulation of cell cycle phase transition
GO:0045595	0.869	regulation of cell differentiation
GO:0060255	0.857	regulation of macromolecule metabolic process
GO:0080090	0.855	regulation of primary metabolic process
GO:0051147	0.854	regulation of muscle cell differentiation
GO:0045787	0.852	positive regulation of cell cycle
GO:1901990	0.827	regulation of mitotic cell cycle phase transition
GO:1902749	0.825	regulation of cell cycle G2/M phase transition
GO:0045931	0.818	positive regulation of mitotic cell cycle
GO:0090068	0.811	positive regulation of cell cycle process
GO:0045597	0.798	positive regulation of cell differentiation
GO:1901989	0.785	positive regulation of cell cycle phase transition
GO:0031323	0.762	regulation of cellular metabolic process
GO:0051171	0.759	regulation of nitrogen compound metabolic process
GO:0019219	0.747	regulation of nucleobase-containing compound metabolic process
GO:1901992	0.707	positive regulation of mitotic cell cycle phase transition
GO:0010468	0.696	regulation of gene expression
GO:0031326	0.694	regulation of cellular biosynthetic process
GO:1902751	0.682	positive regulation of cell cycle G2/M phase transition
GO:0010389	0.635	regulation of G2/M transition of mitotic cell cycle
GO:0010971	0.633	positive regulation of G2/M transition of mitotic cell cycle
GO:0006355	0.631	regulation of DNA-templated transcription
GO:0048856	0.599	anatomical structure development
GO:0032501	0.562	multicellular organismal process
GO:0009893	0.481	positive regulation of metabolic process
GO:0071840	0.470	cellular component organization or biogenesis
GO:0010604	0.462	positive regulation of macromolecule metabolic process
GO:0045935	0.435	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.432	positive regulation of cellular biosynthetic process
GO:0006357	0.430	regulation of transcription by RNA polymerase II
GO:0016043	0.427	cellular component organization
GO:0045893	0.415	positive regulation of DNA-templated transcription
GO:0007275	0.414	multicellular organism development
GO:0050896	0.329	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.985	nuclear lumen
GO:0005654	0.983	nucleoplasm
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0032991	0.925	protein-containing complex
GO:0005694	0.804	chromosome
GO:0000785	0.742	chromatin
GO:0140513	0.727	nuclear protein-containing complex
GO:1902494	0.685	catalytic complex
GO:0005737	0.653	cytoplasm
GO:1904949	0.557	ATPase complex
GO:0070603	0.552	SWI/SNF superfamily-type complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]