StarFunc result for job id Q6T4R5

User Input

>input (1651 residues)
MPFAKRIVEPQWLCRQRRPAPGPAVDASGGSAEPPPPLQPPGRRDLDEVEAPGPEEPARA
VPAPSGLPPPPPPLPAPADQTQPPHGEASVAGEESTAGIPEAAPAAGEASSAAAAAAVLL
MLDLCAVSNAALARVLRQLSDVARHACSLFQELESDIQLTHRRVWALQGKLGGVQRVLST
LDPKQEAVPVSNLDIESKLSVYYRAPWHQQRNIFLPATRPPCVEELHRHARQSLQALRRE
HRSRSDRREQRAAAPLSIAAPPLPAYPPAHSQRRREFKDRHFLTFNSTRSPSPTECCHMT
PWSRKSHPPEDEDTDVMLGQRPKNPIHNIPSTLDKQTNWSKALPLPTPEEKMKQDAQVIS
SCIIPINVTGVGFDREASIRCSLVHSQSVLQRRRKLRRRKTISGIPRRVQQEIDSDESPV
ARERNVIVHTNPDPSNTVNRISGTRDSECQTEDILIAAPSRRRIRAQRGQSIAASLSHSA
GNISALADKGDTMFTPAVSSRTRSRSLPREGNRGGDAEPKVGAKPSAYEEGESFVGDHER
TPNDFSEAPSSPSAQDHQPTLGLACSQHLHSPQHKLSERGRSRLSRMAADSGSCDISSNS
DTFGSPIHCISTAGVLLSSHMDQKDDHQSSSGNWSGSSSTCPSQTSETIPPAASPPLTGS
SHCDSELSLNTAPHANEDASVFVTEQYNDHLDKVRGHRANSFTSTVADLLDDPNNSNTSD
SEWNYLHHHHDASCRQDFSPERPKADSLGCPSFTSMATYDSFLEKSPSDKADTSSHFSVD
TEGYYTSMHFDCGLKGNKSYVCHYAALGPENGQGVGASPGLPDCAWQDYLDHKRQGRPSI
SFRKPKAKPTPPKRSSSLRKSDGNADISEKKEPKISSGQHLPHSSREMKLPLDFANTPSR
MENANLPTKQEPSWINQSEQGIKEPQLDASDIPPFKDEVAESTHYADLWLLNDLKTNDPY
RSLSNSSTATGTTVIECIKSPESSESQTSQSESRATTPSLPSVDNEFKLASPEKLAGLAS
PSSGYSSQSETPTSSFPTAFFSGPLSPGGSKRKPKVPERKSSLQQPSLKDGTISLSKDLE
LPIIPPTHLDLSALHNVLNKPFHHRHPLHVFTHNKQNTVGETLRSNPPPSLAITPTILKS
VNLRSINKSEEVKQKEENNTDLPYLEESTLTTAALSPSKIRPHTANKSVSRQYSTEDTIL
SFLDSSAVEMGPDKLHLEKNSTFDVKNRCDPETITSAGSSLLDSNVTKDQVRTETEPIPE
NTPTKNCAFPTEGFQRVSAARPNDLDGKIIQYGPGPDETLEQVQKAPSAGLEEVAQPESV
DVITSQSDSPTRATDVSNQFKHQFVMSRHHDKVPGTISYESEITSVNSFPEKCSKQENIA
SGISAKSASDNSKAEETQGNVDEASLKESSPSDDSIISPLSEDSQAEAEGVFVSPNKPRT
TEDLFAVIHRSKRKVLGRKDSGDMSVRSKSRAPLSSSSSSASSITSPSSNVTTPNSQRSP
GLIYRNAKKSNTSNEEFKLLLLKKGSRSDSSYRMSATEILKSPILPKPPGELTAESPQST
DDAHQGSQGAEALSPLSPCSPRVNAEGFSSKSFATSASARVGRSRAPPAASSSRYSVRCR
LYNTPMQAISEGETENSDGSPHDDRSSQSST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AV60	0.243	0.244	0.000	1647	0.884	0.886	B1AV60.pdb.gz	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
2	AFDB:Q6T4R5	1.000	1.000	0.000	1651	1.000	1.000	Q6T4R5.pdb.gz	NHS_HUMAN Actin remodeling regulator NHS OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=2
3	AFDB:E7EXR7	0.054	0.055	1.700E-29	1606	0.265	0.272	E7EXR7.pdb.gz	E7EXR7_DANRE NHS-like 1b OS=Danio rerio OX=7955 GN=nhsl1b PE=1 SV=2
4	AFDB:Q5HYW2	0.053	0.066	1.498E-21	1225	0.220	0.297	Q5HYW2.pdb.gz	NHSL2_HUMAN NHS-like protein 2 OS=Homo sapiens OX=9606 GN=NHSL2 PE=1 SV=2
5	AFDB:Q9VE13	0.069	0.065	5.867E-12	1788	0.179	0.165	Q9VE13.pdb.gz	Q9VE13_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=1 SV=3
6	AFDB:P48681	0.032	0.032	2.005E-3	1621	0.113	0.115	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
7	AFDB:P48634	0.047	0.038	5.176E-3	2157	0.176	0.135	P48634.pdb.gz	PRC2A_HUMAN Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3
8	AFDB:P35658	0.036	0.032	6.788E-3	2090	0.142	0.112	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
9	AFDB:F1Q4W7	0.039	0.044	2.298E-2	1454	0.125	0.142	F1Q4W7.pdb.gz	F1Q4W7_DANRE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Danio rerio OX=7955 GN=dot1l PE=1 SV=2
10	AFDB:Q5XPJ9	0.043	0.049	2.632E-2	1399	0.130	0.154	Q5XPJ9.pdb.gz	SCAR2_ARATH Protein SCAR2 OS=Arabidopsis thaliana OX=3702 GN=SCAR2 PE=1 SV=1
11	PDB:6wjv3	0.012	0.165	7.976	85	0.006	0.118	6wjv3.pdb.gz
12	PDB:2m0qA	0.036	0.254	8.535	123	0.012	0.163	2m0qA.pdb.gz
13	PDB:7mq8SS	0.023	0.158	8.535	197	0.015	0.122	7mq8SS.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6ff4C	0.029	0.108	9.133	286	0.021	0.122	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
15	PDB:7lxdA	0.013	0.018	9.133	1190	0.008	0.011	7lxdA.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
16	PDB:6wj2A	0.021	0.169	9.773	96	0.008	0.146	6wj2A.pdb.gz	Structural mechanism for amino acid-dependent Rag GTPase nucleotide state switching by SLC38A9.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WU78	0.0	2927	1447	0.875	0.998	A0A087WU78_HUMAN NHS actin remodeling regulator OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=1
2	B1AV60	0.0	2694	1647	0.879	0.881	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
3	B2RXX7	0.0	2693	1647	0.879	0.881	B2RXX7_MOUSE Nhs protein OS=Mus musculus OX=10090 GN=Nhs PE=2 SV=1
4	B7ZWM3	0.0	2695	1647	0.879	0.881	B7ZWM3_MOUSE Nhs protein OS=Mus musculus OX=10090 GN=Nhs PE=2 SV=1
5	B9EJX2	0.0	2638	1626	0.867	0.880	B9EJX2_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
6	Q6T4R5	0.0	3368	1651	1.000	1.000	NHS_HUMAN Actin remodeling regulator NHS OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=2
7	E7EXR7	9.21e-56	216	1606	0.095	0.098	E7EXR7_DANRE NHS-like 1b OS=Danio rerio OX=7955 GN=nhsl1b PE=1 SV=2
8	Q5HYW2	5.73e-23	109	1225	0.090	0.122	NHSL2_HUMAN NHS-like protein 2 OS=Homo sapiens OX=9606 GN=NHSL2 PE=1 SV=2
9	Q9VE13	3.17e-09	64.7	1788	0.024	0.022	Q9VE13_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=1 SV=3
10	A8JR42	3.56e-09	64.3	1764	0.024	0.023	A8JR42_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=3 SV=2
11	Q4AB30	6.37e-09	63.5	1044	0.024	0.038	Q4AB30_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=1 SV=1
12	Q9VE16	7.61e-09	62.8	534	0.041	0.125	Q9VE16_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=2 SV=2
13	M9NCT2	1.71e-04	48.9	640	0.019	0.050	M9NCT2_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
14	M9PCP4	1.80e-04	48.5	632	0.019	0.051	M9PCP4_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
15	Q9VKM2	1.82e-04	48.5	613	0.019	0.052	Q9VKM2_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
16	F2FB81	2.28e-04	48.5	674	0.019	0.047	F2FB81_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
17	X2J5L4	2.46e-04	48.1	647	0.019	0.049	X2J5L4_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
18	H5V8D0	2.47e-04	48.1	641	0.019	0.050	H5V8D0_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=SCAR PE=1 SV=1
19	Q0IIJ3	0.002	45.4	559	0.017	0.050	WASF1_BOVIN Actin-binding protein WASF1 OS=Bos taurus OX=9913 GN=WASF1 PE=2 SV=1
20	Q5BJU7	0.002	45.1	559	0.017	0.050	WASF1_RAT Actin-binding protein WASF1 OS=Rattus norvegicus OX=10116 GN=Wasf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15273 NHS	9.8e-220	743.4	NHS-like
2	PF06098 Radial_spoke_3	5.6e+02	11.1	Radial spoke protein 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003819577.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003819583.1	0.707	Retinoic acid induced 2
2	9597.XP_003827588.1	0.654	Glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
3	9597.XP_008970988.1	0.526	Heat shock factor protein 1
4	9597.XP_003817563.1	0.504	Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance, lamellipodial and filopodial dynamics, platelet activation and cell migration.
5	9597.XP_003819586.1	0.504	Cyclin dependent kinase like 5
6	9597.XP_008961120.1	0.504	Protein cordon-bleu isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032502	0.787	developmental process
GO:0032501	0.787	multicellular organismal process
GO:0048856	0.774	anatomical structure development
GO:0002088	0.713	lens development in camera-type eye
GO:0048869	0.540	cellular developmental process
GO:0030154	0.478	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0016604	0.998	nuclear body
GO:0005794	0.994	Golgi apparatus
GO:0016020	0.904	membrane
GO:0005886	0.698	plasma membrane
GO:0120025	0.370	plasma membrane bounded cell projection
GO:0005829	0.368	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]