StarFunc result for job id Q6TFL3

User Input

>input (1326 residues)
MNLNTSSNTGDTQRLKIASLDVKQILKNETELDITDNLRKKLHWAKKEKLEITTKHNAEL
ASYESQIAKLRSEVEKGEALRQSLEYDLAVARKEAGLGRRAAEERLAEAHRIQEKLCAQN
SELQAKTNETEKAFQTSQQKWKEECRRFEHDLEERDNMIQNCNREYDLLMKEKSRLEKTL
QEALEKHQREKNEMESHIRETALEEFRLQEEQWEAERRELQFIVQEQDTAVQNMHKKVEK
LETEHMDCSDLLRRQTSELEFSTQREERLRKEFEATTLRVRKLEENIEAERAAHLESKFN
SEIIQLRIRDLEGALQVEKASQAEAVADLEIIKNEFKEVESAYEREKHNAQESFAKLNLL
EKEYFSKNKKLNEDIEEQKKVIIDLSKRLQYNEKSCSELQEELVMAKKHQAFLVETCENN
VKELESILDSFTVSGQWTSGIHKDKDKPPSFSVVLERLRRTLTDYQNKLEDASNEEKACN
ELDSTKQKIDSHTKNIKELQDKLADVNKELSHLHTKCADREALISTLKVELQNVLHCWEK
EKAQAAQSESELQKLSQAFHKDAEEKLTFLHTLYQHLVAGCVLIKQPEGMLDKFSWSELC
AVLQENVDALIADLNRANEKIRHLEYICKNKSDTMRELQQTQEDTFTKVAEQIKAQESCW
HRQKKELELQYSELFLEVQKRAQKFQEIAEKNMEKLNHIEKSHEQLVLENSHFKKLLSQT
QREQMSLLAACALMAGALYPLYSRSCALSTQRDFLQEQVNTFELFKLEIRTLAQALSTVE
EKKQEEAKMKKKTFKGLIRIFRKGVIAVLAANRLKILGQSCASLFTWMESFKEGIGMLVC
TGEPQDKHKFPKHQKEQLRCLQALSWLTSSDLLAAIISSMAELQDVIGKADPNSRICGHL
LIGAAKNSFAKLMDKISLVMECIPLHSSRSITYVEKDSLVQRLAHGLHKVNTLALKYGLR
GHVPITKSTASLQKQILGFTQRLHAAEVERRSLRLEVTEFKRSVNEMKKELDKAQGLQMQ
LNEFKQSKLITHEKFESACEELNNALLREEQAQMLLNEQAQQLQELNYKLELHSSEEADK
NQTLGEAVKSLSEAKMELRRKDQSLRQLNRHLTQLEQDKRRLEENIHDAESALRMAAKDK
ECVANHMRAVENTLHKVRDQISLSWSAASRNDFTLQLPKLHLETFAMEGLKGGPEVVACQ
AMIKSFMDVYQLASTRIMTLEKEMTSHRSHIAALKSELHTACLRENASLQSIGSRDHSNL
SIPSRAPLPADTTGIGDFLPLKAELDTTYTFLKETFINTVPHALTSSHSSPVTMSANANR
PTQIGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0WSY2	0.080	0.105	1.580E-4	982	0.103	0.140	Q0WSY2.pdb.gz	FPP4_ARATH Filament-like plant protein 4 OS=Arabidopsis thaliana OX=3702 GN=FPP4 PE=1 SV=1
2	AFDB:E7EY31	0.089	0.111	5.608E-3	1022	0.132	0.171	E7EY31.pdb.gz	E7EY31_DANRE Coiled-coil domain-containing 57 OS=Danio rerio OX=7955 GN=ccdc57 PE=4 SV=1
3	AFDB:Q9W0M1	0.088	0.061	2.284E-2	1978	0.165	0.111	Q9W0M1.pdb.gz	CE290_DROME Centrosomal protein Cep290 OS=Drosophila melanogaster OX=7227 GN=Cep290 PE=1 SV=2
4	AFDB:Q2TAC2	0.090	0.126	4.887E-2	915	0.100	0.145	Q2TAC2.pdb.gz	CCD57_HUMAN Coiled-coil domain-containing protein 57 OS=Homo sapiens OX=9606 GN=CCDC57 PE=1 SV=3
5	AFDB:F4ISU2	0.090	0.089	1.046E-1	1333	0.180	0.179	F4ISU2.pdb.gz	F4ISU2_ARATH Early endosome antigen OS=Arabidopsis thaliana OX=3702 GN=PICC PE=1 SV=1
6	AFDB:Q8WZK0	0.050	0.093	1.046E-1	695	0.057	0.108	Q8WZK0.pdb.gz	US107_SCHPO U1 snRNP-associated protein usp107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp107 PE=1 SV=1
7	AFDB:I3ISQ9	0.102	0.073	1.109E-1	1954	0.170	0.115	I3ISQ9.pdb.gz
8	AFDB:P25386	0.080	0.063	1.176E-1	1790	0.136	0.101	P25386.pdb.gz	USO1_YEAST Intracellular protein transport protein USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USO1 PE=1 SV=2
9	AFDB:Q15025	0.060	0.108	1.176E-1	636	0.071	0.148	Q15025.pdb.gz	TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=2
10	AFDB:Q57UV7	0.076	0.070	1.246E-1	1456	0.125	0.114	Q57UV7.pdb.gz	Q57UV7_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.660 PE=3 SV=1
11	PDB:4h63H	0.035	0.148	3.935E-1	174	0.017	0.132	4h63H.pdb.gz
12	PDB:5n9jE	0.032	0.127	4.423E-1	201	0.029	0.194	5n9jE.pdb.gz
13	PDB:7np7D1	0.036	0.084	6.662E-1	485	0.028	0.076	7np7D1.pdb.gz
14	PDB:5n9jZ	0.036	0.211	8.419E-1	119	0.011	0.126	5n9jZ.pdb.gz
15	PDB:7w72S	0.036	0.080	2.147	533	0.014	0.034	7w72S.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
16	PDB:7c4jH	0.049	0.183	2.713	242	0.026	0.140	7c4jH.pdb.gz
17	PDB:3jd5O	0.042	0.152	2.877	173	0.014	0.104	3jd5O.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
18	PDB:6uxwA	0.047	0.072	2.877	778	0.023	0.039	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
19	PDB:7l08AL	0.043	0.169	3.050	174	0.019	0.144	7l08AL.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
20	PDB:8escE	0.038	0.096	3.050	440	0.020	0.059	8escE.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q20641	0.059	40.4	1963	0.060	0.041	Q20641_CAEEL Myosin-11 OS=Caenorhabditis elegans OX=6239 GN=nmy-1 PE=1 SV=2
2	Q99323	0.094	39.7	2057	0.045	0.029	MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila melanogaster OX=7227 GN=zip PE=1 SV=2
3	Q6VGS5	0.14	39.3	2009	0.076	0.050	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
4	Q57UV7	0.19	38.9	1456	0.063	0.057	Q57UV7_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.660 PE=3 SV=1
5	H2L0I4	0.23	38.5	2392	0.083	0.046	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
6	H2L0I2	0.26	38.5	2396	0.083	0.046	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
7	H2L0I3	0.40	37.7	2323	0.083	0.047	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
8	P05661	0.75	37.0	1962	0.041	0.028	MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster OX=7227 GN=Mhc PE=1 SV=4
9	Q385J3	0.80	36.6	918	0.044	0.063	Q385J3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3500 PE=4 SV=1
10	Q2KN93	0.99	36.2	1132	0.041	0.049	CYTSA_DANRE Cytospin-A OS=Danio rerio OX=7955 GN=specc1la PE=2 SV=2
11	B6RK61	1.9	35.4	1941	0.048	0.033	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
12	F7F0L5	2.2	35.4	1929	0.048	0.033	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
13	Q9P219	2.7	35.0	2028	0.064	0.042	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
14	P13647	2.9	34.7	590	0.035	0.080	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
15	Q6X1Y7	3.1	34.7	1294	0.029	0.030	Q6X1Y7_LEGPN Effector protein B OS=Legionella pneumophila OX=446 GN=lepB PE=1 SV=1
16	P16946	3.3	34.3	369	0.041	0.146	MX_STRP9 Virulence factor-related M protein OS=Streptococcus pyogenes serotype M49 OX=301452 GN=ennX PE=1 SV=1
17	A0A0G2JY53	7.6	33.5	1922	0.022	0.015	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370200	0.746	snRNA-activating protein complex subunit 3
2	9606.ENSP00000216923	0.696	Zinc finger protein 64 homolog, isoforms 1 and 2
3	9606.ENSP00000422496	0.645	Tetratricopeptide repeat domain containing
4	9606.ENSP00000286364	0.610	Ras GTPase-activating protein 2
5	9606.ENSP00000263991	0.604	EH domain-binding protein 1
6	9606.ENSP00000308339	0.581	Protein transport protein Sec16B
7	9606.ENSP00000321388	0.550	Ankyrin repeat and SOCS box protein 4
8	9606.ENSP00000370021	0.543	Centlein
9	9606.ENSP00000370047	0.541	Zinc finger protein basonuclin-2
10	9606.ENSP00000455426	0.523	Zinc finger protein 423
11	9606.ENSP00000312141	0.519	Zinc finger protein 654
12	9606.ENSP00000360054	0.513	Phosphatase and actin regulator 3
13	9606.ENSP00000412940	0.503	FRAS1-related extracellular matrix protein 1
14	9606.ENSP00000421191	0.503	Immunoglobulin superfamily, member 22
15	9606.ENSP00000330148	0.502	Glutamate receptor ionotropic, delta-1
16	9606.ENSP00000370303	0.502	Palmitoyltransferase ZDHHC21
17	9606.ENSP00000369921	0.501	ADAMTS-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.967	biological regulation
GO:0009987	0.966	cellular process
GO:0050789	0.960	regulation of biological process
GO:0050794	0.908	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005634	0.978	nucleus
GO:0005737	0.830	cytoplasm
GO:0015630	0.830	microtubule cytoskeleton
GO:0012505	0.608	endomembrane system
GO:0070013	0.553	intracellular organelle lumen
GO:0031981	0.534	nuclear lumen
GO:0005813	0.506	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]