StarFunc result for job id Q6TGC4

User Input

>input (694 residues)
MVSVEGRAMSFQSIIHLSLDSPVHAVCVLGTEICLDLSGCAPQKCQCFTIHGSGRVLIDV
ANTVISEKEDATIWWPLSDPTYATVKMTSPSPSVDADKVSVTYYGPNEDAPVGTAVLYLT
GIEVSLEVDIYRNGQVEMSSDKQAKKKWIWGPSGWGAILLVNCNPADVGQQLEDKKTKKV
IFSEEITNLSQMTLNVQGPSCILKKYRLVLHTSKEESKKARVYWPQKDNSSTFELVLGPD
QHAYTLALLGNHLKETFYVEAIAFPSAEFSGLISYSVSLVEESQDPSIPETVLYKDTVVF
RVAPCVFIPCTQVPLEVYLCRELQLQGFVDTVTKLSEKSNSQVASVYEDPNRLGRWLQDE
MAFCYTQAPHKTTSLILDTPQAADLDEFPMKYSLSPGIGYMIQDTEDHKVASMDSIGNLM
VSPPVKVQGKEYPLGRVLIGSSFYPSAEGRAMSKTLRDFLYAQQVQAPVELYSDWLMTGH
VDEFMCFIPTDDKNEGKKGFLLLLASPSACYKLFREKQKEGYGDALLFDELRADQLLSNG
REAKTIDQLLADESLKKQNEYVEKCIHLNRDILKTELGLVEQDIIEIPQLFCLEKLTNIP
SDQQPKRSFARPYFPDLLRMIVMGKNLGIPKPFGPQIKGTCCLEEKICCLLEPLGFKCTF
INDFDCYLTEVGDICACANIRRVPFAFKWWKMVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6TGC4	1.000	1.000	0.000	694	1.000	1.000	Q6TGC4.pdb.gz	PADI6_HUMAN Protein-arginine deiminase type-6 OS=Homo sapiens OX=9606 GN=PADI6 PE=1 SV=3
2	AFDB:Q8K3V4	0.948	0.965	0.000	682	0.666	0.677	Q8K3V4.pdb.gz	PADI6_MOUSE Protein-arginine deiminase type-6 OS=Mus musculus OX=10090 GN=Padi6 PE=1 SV=2
3	AFDB:Q9UM07	0.891	0.931	4.514E-91	663	0.444	0.465	Q9UM07.pdb.gz	PADI4_HUMAN Protein-arginine deiminase type-4 OS=Homo sapiens OX=9606 GN=PADI4 PE=1 SV=2
4	AFDB:O88807	0.882	0.918	3.219E-90	666	0.442	0.461	O88807.pdb.gz	PADI4_RAT Protein-arginine deiminase type-4 OS=Rattus norvegicus OX=10116 GN=Padi4 PE=2 SV=1
5	AFDB:Q9Z183	0.886	0.922	2.428E-89	666	0.431	0.449	Q9Z183.pdb.gz	PADI4_MOUSE Protein-arginine deiminase type-4 OS=Mus musculus OX=10090 GN=Padi4 PE=1 SV=3
6	AFDB:F1NP39	0.873	0.901	1.829E-87	672	0.441	0.455	F1NP39.pdb.gz	F1NP39_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD3 PE=1 SV=1
7	AFDB:Q9ULC6	0.868	0.907	3.788E-86	663	0.438	0.459	Q9ULC6.pdb.gz	PADI1_HUMAN Protein-arginine deiminase type-1 OS=Homo sapiens OX=9606 GN=PADI1 PE=1 SV=2
8	PDB:5n0zA	0.856	0.927	7.912E-86	638	0.444	0.483	5n0zA.pdb.gz	Development of a Selective Inhibitor of Protein Arginine Deiminase 2.
9	AFDB:E1C0W6	0.868	0.910	3.783E-85	661	0.441	0.463	E1C0W6.pdb.gz	E1C0W6_CHICK protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD1 PE=2 SV=1
10	AFDB:Q08642	0.865	0.891	2.854E-84	673	0.422	0.435	Q08642.pdb.gz	PADI2_MOUSE Protein-arginine deiminase type-2 OS=Mus musculus OX=10090 GN=Padi2 PE=1 SV=2
11	AFDB:P70708	0.870	0.908	4.729E-84	664	0.425	0.444	P70708.pdb.gz	PADI3_RAT Protein-arginine deiminase type-3 OS=Rattus norvegicus OX=10116 GN=Padi3 PE=2 SV=1
12	PDB:4n2iA	0.840	0.878	2.418E-81	662	0.429	0.450	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
13	PDB:4x8gA	0.820	0.935	7.858E-81	606	0.425	0.487	4x8gA.pdb.gz	Inhibition of PAD4 activity is sufficient to disrupt mouse and human NET formation.
14	PDB:4n20A	0.821	0.888	1.229E-79	639	0.425	0.462	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
15	PDB:5hp5A	0.878	0.909	2.698E-79	669	0.438	0.454	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
16	PDB:7d56C	0.835	0.903	2.690E-77	640	0.419	0.455	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
17	PDB:7d4yB	0.785	0.901	3.183E-77	601	0.406	0.469	7d4yB.pdb.gz
18	PDB:3apnA	0.763	0.936	2.401E-76	563	0.412	0.508	3apnA.pdb.gz
19	PDB:3h7cX	0.300	0.519	3.236E-7	369	0.071	0.133	3h7cX.pdb.gz	Structural Insights into the Catalytic Mechanism of Arabidopsis thaliana Agmatine Deiminase
20	PDB:4nehA	0.114	0.080	1.175E-5	1084	0.052	0.033	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1C0W6	0.0	566	661	0.448	0.470	E1C0W6_CHICK protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD1 PE=2 SV=1
2	F1NP39	0.0	581	672	0.448	0.463	F1NP39_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD3 PE=1 SV=1
3	G1T837	0.0	547	665	0.428	0.447	G1T837_RABIT Protein-arginine deiminase OS=Oryctolagus cuniculus OX=9986 GN=PADI2 PE=3 SV=2
4	O57400	0.0	582	672	0.451	0.466	O57400_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 PE=2 SV=1
5	O88806	0.0	536	662	0.429	0.450	PADI1_RAT Protein-arginine deiminase type-1 OS=Rattus norvegicus OX=10116 GN=Padi1 PE=1 SV=1
6	O88807	0.0	601	666	0.450	0.468	PADI4_RAT Protein-arginine deiminase type-4 OS=Rattus norvegicus OX=10116 GN=Padi4 PE=2 SV=1
7	P20717	0.0	550	665	0.431	0.450	PADI2_RAT Protein-arginine deiminase type-2 OS=Rattus norvegicus OX=10116 GN=Padi2 PE=1 SV=1
8	P70708	0.0	565	664	0.427	0.446	PADI3_RAT Protein-arginine deiminase type-3 OS=Rattus norvegicus OX=10116 GN=Padi3 PE=2 SV=1
9	Q08642	0.0	548	673	0.429	0.443	PADI2_MOUSE Protein-arginine deiminase type-2 OS=Mus musculus OX=10090 GN=Padi2 PE=1 SV=2
10	Q6TGC4	0.0	1438	694	1.000	1.000	PADI6_HUMAN Protein-arginine deiminase type-6 OS=Homo sapiens OX=9606 GN=PADI6 PE=1 SV=3
11	Q8K3V4	0.0	972	682	0.666	0.677	PADI6_MOUSE Protein-arginine deiminase type-6 OS=Mus musculus OX=10090 GN=Padi6 PE=1 SV=2
12	Q9ULC6	0.0	573	663	0.444	0.465	PADI1_HUMAN Protein-arginine deiminase type-1 OS=Homo sapiens OX=9606 GN=PADI1 PE=1 SV=2
13	Q9ULW8	0.0	569	664	0.428	0.447	PADI3_HUMAN Protein-arginine deiminase type-3 OS=Homo sapiens OX=9606 GN=PADI3 PE=1 SV=2
14	Q9UM07	0.0	601	663	0.442	0.463	PADI4_HUMAN Protein-arginine deiminase type-4 OS=Homo sapiens OX=9606 GN=PADI4 PE=1 SV=2
15	Q9Y2J8	0.0	550	665	0.438	0.457	PADI2_HUMAN Protein-arginine deiminase type-2 OS=Homo sapiens OX=9606 GN=PADI2 PE=1 SV=2
16	Q9Z183	0.0	592	666	0.434	0.452	PADI4_MOUSE Protein-arginine deiminase type-4 OS=Mus musculus OX=10090 GN=Padi4 PE=1 SV=3
17	Q9Z184	0.0	569	664	0.428	0.447	PADI3_MOUSE Protein-arginine deiminase type-3 OS=Mus musculus OX=10090 GN=Padi3 PE=1 SV=2
18	Q9Z185	0.0	536	662	0.431	0.452	PADI1_MOUSE Protein-arginine deiminase type-1 OS=Mus musculus OX=10090 GN=Padi1 PE=1 SV=1
19	Q6PFK7	1.74e-158	474	647	0.372	0.399	Q6PFK7_DANRE protein-arginine deiminase OS=Danio rerio OX=7955 GN=zgc:66317 PE=1 SV=1
20	Q53HY9	9.62e-13	67.0	105	0.055	0.362	Q53HY9_HUMAN PADI4 protein (Fragment) OS=Homo sapiens OX=9606 GN=PADI4 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03068 PAD	4.7e-152	518.2	Protein-arginine deiminase (PAD)
2	PF08527 PAD_M	1.3e-55	198.9	Protein-arginine deiminase (PAD) middle domain
3	PF08526 PAD_N	8.8e-40	147.0	Protein-arginine deiminase (PAD) N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483125

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359384	0.823	Oocyte-expressed protein homolog
2	9606.ENSP00000340989	0.803	14-3-3 protein sigma
3	9606.ENSP00000246112	0.790	Transducin-like enhancer protein 6
4	9606.ENSP00000381032	0.745	Nucleoplasmin-2
5	9606.ENSP00000329803	0.733	Zygote arrest protein 1
6	9606.ENSP00000375063	0.722	NACHT, LRR and PYD domains-containing protein 5
7	9606.ENSP00000359392	0.687	KHDC3-like protein
8	9606.ENSP00000480484	0.609	Trichohyalin
9	9606.ENSP00000333097	0.587	Factor in the germline alpha
10	9606.ENSP00000437289	0.569	ZAR1-like protein
11	9606.ENSP00000357789	0.556	Filaggrin
12	9606.ENSP00000357753	0.539	Involucrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004668	1.000	protein-arginine deiminase activity
GO:0042802	0.515	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.817	biological regulation
GO:0050789	0.793	regulation of biological process
GO:0050794	0.756	regulation of cellular process
GO:0032502	0.727	developmental process
GO:0048856	0.656	anatomical structure development
GO:0032501	0.626	multicellular organismal process
GO:0071840	0.615	cellular component organization or biogenesis
GO:0016043	0.584	cellular component organization
GO:0071704	0.542	organic substance metabolic process
GO:0044238	0.512	primary metabolic process
GO:0006807	0.476	nitrogen compound metabolic process
GO:0019222	0.370	regulation of metabolic process
GO:0060255	0.356	regulation of macromolecule metabolic process
GO:1901564	0.350	organonitrogen compound metabolic process
GO:0080090	0.315	regulation of primary metabolic process
GO:0051171	0.315	regulation of nitrogen compound metabolic process
GO:0043170	0.310	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.902	organelle
GO:0043227	0.885	membrane-bounded organelle
GO:0043229	0.849	intracellular organelle
GO:0043231	0.681	intracellular membrane-bounded organelle
GO:0043232	0.387	intracellular non-membrane-bounded organelle
GO:0005829	0.345	cytosol
GO:0031982	0.327	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18089	1.000	H2O + L-arginyl-[protein] = L-citrullyl-[protein] + NH4(+)
EC:3.5.3.15	1.000	protein-arginine deiminase.

[back to server]