StarFunc result for job id Q6U841

User Input

>input (1118 residues)
MEIKDQGAQMEPLLPTRNDEEAVVDRGGTRSILKTHFEKEDLEGHRTLFIGVHVPLGGRK
SHRRHRHRGHKHRKRDRERDSGLEDGRESPSFDTPSQRVQFILGTEDDDEEHIPHDLFTE
LDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVL
LDMHANTLEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQHHHQNQKKLTNRIPIVRSFA
DIGKKQSEPNSMDKNAGQVVSPQSAPACVENKNDVSRENSTVDFSKGLGGQQKGHTSPCG
MKQRHEKGPPHQQEREVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQG
LAEVPIPTRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEF
LDQVTVLPPGEWDPSIRIEPPKNVPSQEKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTG
RIFGGLILDIKRKAPYFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRIS
AIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLW
TATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSEAYPINMHNDLE
LLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLTVSECKSLHGEYVGRACGHDHP
YVPDVLFWSVILFFSTVTLSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIG
IPSPKLQVPSVFKPTRDDRGWFVTPLGPNPWWTVIAAIIPALLCTILIFMDQQITAVIIN
RKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQ
PKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQFFDRIK
LFWMPAKHQPDFIYLRHVPLRKVHLFTIIQMSCLGLLWIIKVSRAAIVFPMMVLALVFVR
KLMDLLFTKRELSWLDDLMPESKKKKLEDAEKEEEQSMLAMEDEGTVQLPLEGHYRDDPS
VINISDEMSKTALWRNLLITADNSKDKESSFPSKSSPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2Y0W8	0.804	0.821	0.000	1093	0.748	0.765	Q2Y0W8.pdb.gz	S4A8_HUMAN Electroneutral sodium bicarbonate exchanger 1 OS=Homo sapiens OX=9606 GN=SLC4A8 PE=1 SV=1
2	AFDB:Q5DTL9	0.888	0.888	0.000	1118	0.976	0.976	Q5DTL9.pdb.gz	S4A10_MOUSE Sodium-driven chloride bicarbonate exchanger OS=Mus musculus OX=10090 GN=Slc4a10 PE=1 SV=2
3	AFDB:Q9R1N3	0.761	0.701	0.000	1218	0.716	0.657	Q9R1N3.pdb.gz	S4A7_RAT Sodium bicarbonate cotransporter 3 OS=Rattus norvegicus OX=10116 GN=Slc4a7 PE=1 SV=1
4	AFDB:Q8BTY2	0.541	0.575	8.105E-104	1034	0.657	0.711	Q8BTY2.pdb.gz	S4A7_MOUSE Sodium bicarbonate cotransporter 3 OS=Mus musculus OX=10090 GN=Slc4a7 PE=1 SV=2
5	AFDB:Q8IPI3	0.693	0.653	1.611E-96	1190	0.478	0.449	Q8IPI3.pdb.gz	Q8IPI3_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=2
6	AFDB:F1QHT2	0.647	0.667	6.199E-94	1082	0.500	0.517	F1QHT2.pdb.gz
7	AFDB:E9Q3M5	0.543	0.544	8.060E-94	1116	0.479	0.479	E9Q3M5.pdb.gz	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
8	AFDB:M9PC95	0.636	0.675	2.603E-91	1046	0.461	0.492	M9PC95.pdb.gz	M9PC95_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
9	AFDB:M9PCT2	0.620	0.669	1.103E-90	1027	0.458	0.499	M9PCT2.pdb.gz	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
10	AFDB:O13134	0.650	0.697	1.315E-90	1035	0.482	0.521	O13134.pdb.gz	S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum OX=8305 GN=SLC4A4 PE=2 SV=1
11	PDB:8cs9g	0.454	0.605	7.250E-58	832	0.279	0.375	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:7tvzA	0.556	0.710	8.704E-55	850	0.285	0.375	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
13	PDB:6caaA	0.406	0.932	1.461E-34	477	0.264	0.618	6caaA.pdb.gz
14	PDB:4yzfA	0.408	0.949	7.707E-34	475	0.186	0.438	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
15	PDB:5l25A	0.294	0.754	2.971E-13	399	0.104	0.291	5l25A.pdb.gz
16	PDB:7lguA	0.289	0.455	1.132E-8	680	0.059	0.097	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
17	PDB:7ch1A	0.250	0.404	2.259E-6	640	0.060	0.105	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
18	PDB:5i6cA	0.256	0.512	4.060E-5	480	0.056	0.131	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
19	PDB:3qe7A	0.244	0.560	1.647E-4	407	0.064	0.177	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
20	PDB:1a6jB	0.072	0.451	3.146E-2	157	0.018	0.127	1a6jB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096X8J7	648	1170	0.323	0.309	B3A3_DANRE Anion exchange protein 3 OS=Danio rerio OX=7955 GN=Slc4a3 PE=2 SV=1
2	A0A2R8QD45	1070	1073	0.500	0.521	A0A2R8QD45_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=id:ibd2520 PE=1 SV=1
3	A0A494BA31	694	952	0.334	0.392	B3A4_MOUSE Anion exchange protein 4 OS=Mus musculus OX=10090 GN=Slc4a9 PE=1 SV=1
4	A0A494BAK5	687	821	0.333	0.453	A0A494BAK5_MOUSE Anion exchange protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
5	A0A494BBC3	635	918	0.317	0.386	A0A494BBC3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
6	A9NIM6	680	1232	0.347	0.315	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
7	B0S7B8	644	1228	0.351	0.319	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1
8	B3WFV9	887	1215	0.443	0.407	B3WFV9_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=2
9	E9PUP3	644	929	0.318	0.382	E9PUP3_MOUSE Anion exchange protein OS=Mus musculus OX=10090 GN=Slc4a9 PE=3 SV=1
10	E9Q3M5	993	1116	0.465	0.466	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
11	G5EC65	944	1119	0.451	0.450	G5EC65_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
12	G5EDF4	943	1161	0.447	0.431	G5EDF4_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
13	M9PB59	1045	1134	0.487	0.481	M9PB59_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
14	M9PB60	1048	1126	0.479	0.476	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
15	M9PC92	1040	1086	0.475	0.489	M9PC92_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
16	M9PC95	1028	1046	0.453	0.485	M9PC95_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
17	M9PCF0	1033	1067	0.453	0.474	M9PCF0_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
18	M9PCT2	1024	1027	0.453	0.494	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
19	M9PF01	1030	1053	0.452	0.480	M9PF01_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
20	O13134	1038	1035	0.471	0.509	S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum OX=8305 GN=SLC4A4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07565 Band_3_cyto	1.7e-102	354.3	Band 3 cytoplasmic domain
2	PF07931 CPT	7.5e+02	11.3	Chloramphenicol phosphotransferase-like protein
3	PF00955 HCO3_cotransp	3.6e-233	786.5	HCO3- transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393066

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358814	0.752	S-adenosylhomocysteine hydrolase-like protein 1
2	9606.ENSP00000262613	0.720	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
3	9606.ENSP00000262461	0.693	Solute carrier family 12 member 2
4	9606.ENSP00000321691	0.682	Glutamine amidotransferase-like class 1 domain-containing protein 1
5	9606.ENSP00000263980	0.671	Sodium/hydrogen exchanger 1
6	9606.ENSP00000299798	0.615	Sodium/hydrogen exchanger 5
7	9606.ENSP00000284885	0.607	Enteropeptidase
8	9606.ENSP00000331727	0.594	Potassium voltage-gated channel subfamily H member 7
9	9606.ENSP00000311165	0.586	Aquaporin-1
10	9606.ENSP00000387694	0.578	Solute carrier family 12 member 5
11	9606.ENSP00000233969	0.555	Sodium/hydrogen exchanger 2
12	9606.ENSP00000264938	0.555	Sodium/hydrogen exchanger 3
13	9606.ENSP00000378920	0.532	Solute carrier family 26 member 6
14	9606.ENSP00000265715	0.507	Pendrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008510	1.000	sodium:bicarbonate symporter activity
GO:0015108	0.999	chloride transmembrane transporter activity
GO:0005452	0.998	solute:inorganic anion antiporter activity
GO:0140828	0.998	metal cation:monoatomic cation antiporter activity
GO:0005515	0.996	protein binding
GO:0140900	0.510	chloride:bicarbonate antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.991	localization
GO:0065007	0.990	biological regulation
GO:0006885	0.962	regulation of pH
GO:0006810	0.957	transport
GO:0009987	0.950	cellular process
GO:0006811	0.661	monoatomic ion transport
GO:0050789	0.550	regulation of biological process
GO:0019725	0.509	cellular homeostasis
GO:0050794	0.436	regulation of cellular process
GO:0055082	0.419	intracellular chemical homeostasis
GO:0071702	0.383	organic substance transport
GO:0006873	0.382	intracellular monoatomic ion homeostasis
GO:0030003	0.368	intracellular monoatomic cation homeostasis
GO:0030641	0.313	regulation of cellular pH

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.788	plasma membrane region
GO:0043226	0.704	organelle
GO:0043227	0.688	membrane-bounded organelle
GO:0045178	0.682	basal part of cell
GO:0016323	0.670	basolateral plasma membrane
GO:0005737	0.658	cytoplasm
GO:0045177	0.475	apical part of cell
GO:0016324	0.441	apical plasma membrane
GO:0042995	0.309	cell projection
GO:0120025	0.300	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28695	1.000	hydrogencarbonate(in) = hydrogencarbonate(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29823	0.999	chloride(in) = chloride(out)

[back to server]