StarFunc result for job id Q6UB35

User Input

>input (978 residues)
MGTRLPLVLRQLRRPPQPPGPPRRLRVPCRASSGGGGGGGGGREGLLGQRRPQDGQARSS
CSPGGRTPAARDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAE
EAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLALQISENLFSNKVLNALKPEKDVD
GVTDINLGKLVRGDAHECFVSPVAKAVIELLEKSGVNLDGKKILVVGAHGSLEAALQCLF
QRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKV
GCGSPRIHFGGLIEEDDVILLAAALRIQNMVSSGRRWLREQQHRRWRLHCLKLQPLSPVP
SDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKVRLSVLERLKDQADGKYVLVAGI
TPTPLGEGKSTVTIGLVQALTAHLNVNSFACLRQPSQGPTFGVKGGAAGGGYAQVIPMEE
FNLHLTGDIHAITAANNLLAAAIDTRILHENTQTDKALYNRLVPLVNGVREFSEIQLARL
KKLGINKTDPSTLTEEEVSKFARLDIDPSTITWQRVLDTNDRFLRKITIGQGNTEKGHYR
QAQFDIAVASEIMAVLALTDSLADMKARLGRMVVASDKSGQPVTADDLGVTGALTVLMKD
AIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGM
EKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCN
LQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVD
LARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGF
GNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRP
CFYDIDLDTETEQVKGLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7ZM99	0.929	0.928	0.000	979	0.999	0.998	B7ZM99.pdb.gz	B7ZM99_HUMAN formate--tetrahydrofolate ligase OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1
2	AFDB:F5H2F4	0.791	0.801	0.000	964	0.550	0.558	F5H2F4.pdb.gz	F5H2F4_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=2
3	AFDB:O43007	0.861	0.866	0.000	972	0.443	0.445	O43007.pdb.gz	C1TM_SCHPO C-1-tetrahydrofolate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade9 PE=3 SV=3
4	AFDB:O96553	0.849	0.857	0.000	968	0.492	0.497	O96553.pdb.gz	C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=pug PE=2 SV=4
5	AFDB:P07245	0.873	0.901	0.000	946	0.474	0.490	P07245.pdb.gz	C1TC_YEAST C-1-tetrahydrofolate synthase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE3 PE=1 SV=1
6	AFDB:P09440	0.876	0.879	0.000	975	0.470	0.472	P09440.pdb.gz	C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIS1 PE=1 SV=1
7	AFDB:Q3V3R1	0.959	0.960	0.000	977	0.883	0.884	Q3V3R1.pdb.gz	C1TM_MOUSE Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Mthfd1l PE=1 SV=2
8	AFDB:Q6FND0	0.830	0.856	0.000	946	0.474	0.490	Q6FND0.pdb.gz	Q6FND0_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K00913g PE=3 SV=1
9	AFDB:Q8WZJ7	0.845	0.880	0.000	937	0.485	0.506	Q8WZJ7.pdb.gz	C1TC_SCHPO C-1-tetrahydrofolate synthase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC839.16 PE=3 SV=1
10	AFDB:Q54G53	0.643	0.984	1.905E-98	638	0.435	0.666	Q54G53.pdb.gz	Q54G53_DICDI formate--tetrahydrofolate ligase OS=Dictyostelium discoideum OX=44689 GN=fthS PE=3 SV=1
11	PDB:4a26A	0.241	0.704	5.989E-16	296	0.062	0.206	4a26A.pdb.gz
12	PDB:4cjxA	0.237	0.737	2.690E-15	297	0.062	0.205	4cjxA.pdb.gz	Characterization of 2,4-Diamino-6-Oxo-1,6-Dihydropyrimidin-5-Yl Ureido Based Inhibitors of Trypanosoma Brucei Fold and Testing for Antiparasitic Activity.
13	PDB:1b0aA	0.236	0.720	6.016E-15	287	0.063	0.216	1b0aA.pdb.gz
14	PDB:2c2xA	0.231	0.729	1.029E-14	280	0.062	0.218	2c2xA.pdb.gz
15	PDB:6s4fB	0.243	0.733	1.275E-14	298	0.065	0.215	6s4fB.pdb.gz	Pharmacological targeting of MTHFD2 suppresses acute myeloid leukemia by inducing thymidine depletion and replication stress.
16	PDB:1ee9A	0.226	0.650	7.194E-11	317	0.051	0.158	1ee9A.pdb.gz	The X-ray structure of the NAD-dependent 5,10-methylenetetrahydrofolate dehydrogenase from Saccharomyces cerevisiae.
17	PDB:1npdB	0.177	0.512	3.261E-8	288	0.049	0.167	1npdB.pdb.gz	The 2.3-A crystal structure of the shikimate 5-dehydrogenase orthologue YdiB from Escherichia coli suggests a novel catalytic environment for an NAD-dependent dehydrogenase
18	PDB:4njmA	0.098	0.274	4.789E-6	303	0.031	0.099	4njmA.pdb.gz	Crystal structures and kinetics of Type III 3-phosphoglycerate dehydrogenase reveal catalysis by lysine.
19	PDB:1sc6D	0.087	0.202	7.762E-6	384	0.039	0.099	1sc6D.pdb.gz	Multiconformational states in phosphoglycerate dehydrogenase
20	PDB:2hk9A	0.180	0.556	1.401E-5	269	0.046	0.167	2hk9A.pdb.gz	Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WVM4	1841	913	0.923	0.989	A0A087WVM4_HUMAN formate--tetrahydrofolate ligase OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1
2	B7ZM99	1993	979	1.000	0.999	B7ZM99_HUMAN formate--tetrahydrofolate ligase OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1
3	F5H2F4	1061	964	0.557	0.565	F5H2F4_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=2
4	H0Y327	672	332	0.337	0.994	H0Y327_HUMAN Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1 like (Fragment) OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1
5	O43007	816	972	0.449	0.452	C1TM_SCHPO C-1-tetrahydrofolate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade9 PE=3 SV=3
6	O96553	899	968	0.500	0.505	C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=pug PE=2 SV=4
7	P07245	818	946	0.478	0.494	C1TC_YEAST C-1-tetrahydrofolate synthase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE3 PE=1 SV=1
8	P09440	821	975	0.468	0.470	C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIS1 PE=1 SV=1
9	P11586	1119	935	0.585	0.612	C1TC_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=4
10	P27653	1124	935	0.582	0.609	C1TC_RAT C-1-tetrahydrofolate synthase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mthfd1 PE=1 SV=3
11	Q3V3R1	1689	977	0.883	0.884	C1TM_MOUSE Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Mthfd1l PE=1 SV=2
12	Q4Q735	693	622	0.376	0.592	Q4Q735_LEIMA formate--tetrahydrofolate ligase OS=Leishmania major OX=5664 GN=FTHS PE=3 SV=1
13	Q54G53	831	638	0.435	0.666	Q54G53_DICDI formate--tetrahydrofolate ligase OS=Dictyostelium discoideum OX=44689 GN=fthS PE=3 SV=1
14	Q6FND0	883	946	0.482	0.498	Q6FND0_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K00913g PE=3 SV=1
15	Q6UB35	1999	978	1.000	1.000	C1TM_HUMAN Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1
16	Q8WZJ7	844	937	0.484	0.505	C1TC_SCHPO C-1-tetrahydrofolate synthase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC839.16 PE=3 SV=1
17	Q922D8	1108	935	0.583	0.610	C1TC_MOUSE C-1-tetrahydrofolate synthase, cytoplasmic OS=Mus musculus OX=10090 GN=Mthfd1 PE=1 SV=4
18	Q9SPK5	818	634	0.420	0.648	FTHS_ARATH Formate--tetrahydrofolate ligase OS=Arabidopsis thaliana OX=3702 GN=THFS PE=2 SV=1
19	V9GYY3	1063	922	0.558	0.592	V9GYY3_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=2
20	V9GZ78	1077	854	0.559	0.641	V9GZ78_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01268 FTHFS	5.8e-257	865.0	Formate--tetrahydrofolate ligase
2	PF08241 Methyltransf_11	3.6e+02	13.2	Methyltransferase domain
3	PF00763 THF_DHG_CYH	1.3e-08	46.4	Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
4	PF02882 THF_DHG_CYH_C	2.9e-21	86.9	Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000031922

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000045223	0.999	Trifunctional purine biosynthetic protein adenosine-3
2	9598.ENSPTRP00000020731	0.991	Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase
3	9598.ENSPTRP00000051007	0.991	Catalyzes the transfer of a methyl group from methyl- cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Subsequently, remethylates the cofactor using methyltetrahydrofolate
4	9598.ENSPTRP00000025761	0.971	Aminomethyltransferase
5	9598.ENSPTRP00000027781	0.968	Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like
6	9598.ENSPTRP00000029175	0.966	Dihydrofolate reductase
7	9598.ENSPTRP00000026122	0.960	Uncharacterized protein
8	9598.ENSPTRP00000041425	0.951	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
9	9598.ENSPTRP00000015094	0.948	Serine hydroxymethyltransferase
10	9598.ENSPTRP00000036574	0.917	Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis
11	9598.ENSPTRP00000049477	0.904	Glycine cleavage system P protein
12	9598.ENSPTRP00000012576	0.896	Belongs to the 5-formyltetrahydrofolate cyclo-ligase family
13	9598.ENSPTRP00000010916	0.872	Uncharacterized protein
14	9598.ENSPTRP00000008712	0.859	Serine hydroxymethyltransferase
15	9598.ENSPTRP00000009141	0.850	Aldehyde dehydrogenase 1 family, member L2
16	9598.ENSPTRP00000024129	0.819	Uncharacterized protein
17	9598.ENSPTRP00000014392	0.802	Methenyltetrahydrofolate synthetase domain containing
18	9598.ENSPTRP00000035968	0.740	Phosphoserine aminotransferase 1
19	9598.ENSPTRP00000016716	0.727	Pan troglodytes thymidylate synthetase (TYMS), mRNA
20	9598.ENSPTRP00000000294	0.696	Belongs to the methylenetetrahydrofolate reductase family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004329	1.000	formate-tetrahydrofolate ligase activity
GO:0043168	0.999	anion binding
GO:0016646	0.998	oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
GO:0042803	0.998	protein homodimerization activity
GO:0017076	0.997	purine nucleotide binding
GO:0004486	0.992	methylenetetrahydrofolate dehydrogenase [NAD(P)+] activity
GO:0005524	0.991	ATP binding
GO:0019238	0.954	cyclohydrolase activity
GO:0004477	0.861	methenyltetrahydrofolate cyclohydrolase activity
GO:0004488	0.856	methylenetetrahydrofolate dehydrogenase (NADP+) activity
GO:0003676	0.851	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.994	cellular metabolic process
GO:1901576	0.985	organic substance biosynthetic process
GO:0044249	0.981	cellular biosynthetic process
GO:0044281	0.976	small molecule metabolic process
GO:1901564	0.976	organonitrogen compound metabolic process
GO:1901360	0.968	organic cyclic compound metabolic process
GO:0006725	0.967	cellular aromatic compound metabolic process
GO:0006575	0.960	cellular modified amino acid metabolic process
GO:0042558	0.955	pteridine-containing compound metabolic process
GO:0006760	0.950	folic acid-containing compound metabolic process
GO:0043436	0.946	oxoacid metabolic process
GO:0043648	0.943	dicarboxylic acid metabolic process
GO:0044283	0.922	small molecule biosynthetic process
GO:0046394	0.892	carboxylic acid biosynthetic process
GO:0043650	0.756	dicarboxylic acid biosynthetic process
GO:0044238	0.464	primary metabolic process
GO:0034641	0.445	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.919	intracellular organelle lumen
GO:0016020	0.794	membrane
GO:0005759	0.429	mitochondrial matrix
GO:0031981	0.338	nuclear lumen
GO:0005654	0.312	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20221	1.000	(6S)-5,6,7,8-tetrahydrofolate + ATP + formate = (6R)-10-formyltetrahydrofolate + ADP + phosphate
EC:6.3.4.3	1.000	formate--tetrahydrofolate ligase.
EC:1.5.1.-	0.998	With NAD(+) or NADP(+) as acceptor.
EC:1.5.1.5	0.992	methylenetetrahydrofolate dehydrogenase (NADP(+)).
EC:3.5.4.-	0.954	In cyclic amidines.
RHEA:23700	0.861	(6R)-5,10-methenyltetrahydrofolate + H2O = (6R)-10-formyltetrahydrofolate + H(+)
EC:3.5.4.9	0.861	methenyltetrahydrofolate cyclohydrolase.
RHEA:22812	0.856	(6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + NADP(+) = (6R)-5,10-methenyltetrahydrofolate + NADPH

[back to server]