StarFunc result for job id Q6UB98

User Input

>input (2062 residues)
MPKSGFTKPIQSENSDSDSNMVEKPYGRKSKDKIASYSKTPKIERSDVSKEMKEKSSMKR
KLPFTISPSRNEERDSDTDSDPGHTSENWGERLISSYRTYSEKEGPEKKKTKKEAGNKKS
TPVSILFGYPLSERKQMALLMQMTARDNSPDSTPNHPSQTTPAQKKTPSSSSRQKDKVNK
RNERGETPLHMAAIRGDVKQVKELISLGANVNVKDFAGWTPLHEACNVGYYDVAKILIAA
GADVNTQGLDDDTPLHDSASSGHRDIVKLLLRHGGNPFQANKHGERPVDVAETEELELLL
KREVPLSDDDESYTDSEEAQSVNPSSVDENIDSETEKDSLICESKQILPSKTPLPSALDE
YEFKDDDDEEINKMIDDRHILRKEQRKENEPEAEKTHLFAKQEKAFYPKSFKSKKQKPSR
VLYSSTESSDEEALQNKKISTSCSVIPETSNSDMQTKKEYVVSGEHKQKGKVKRKLKNQN
KNKENQELKQEKEGKENTRITNLTVNTGLDCSEKTREEGNFRKSFSPKDDTSLHLFHIST
GKSPKHSCGLSEKQSTPLKQEHTKTCLSPGSSEMSLQPDLVRYDNTESEFLPESSSVKSC
KHKEKSKHQKDFHLEFGEKSNAKIKDEDHSPTFENSDCTLKKMDKEGKTLKKHKLKHKER
EKEKHKKEIEGEKEKYKTKDSAKELQRSVEFDREFWKENFFKSDETEDLFLNMEHESLTL
EKKSKLEKNIKDDKSTKEKHVSKERNFKEERDKIKKESEKSFREEKIKDLKEERENIPTD
KDSEFTSLGMSAIEESIGLHLVEKEIDIEKQEKHIKESKEKPEKRSQIKEKDIEKMERKT
FEKEKKIKHEHKSEKDKLDLSECVDKIKEKDKLYSHHTEKCHKEGEKSKNTAAIKKTDDR
EKSREKMDRKHDKEKPEKERHLAESKEKHLMEKKNKQSDNSEYSKSEKGKNKEKDRELDK
KEKSRDKESINITNSKHIQEEKKSSIVDGNKAQHEKPLSLKEKTKDEPLKTPDGKEKDKK
DKDIDRYKERDKHKDKIQINSLLKLKSEADKPKPKSSPASKDTRPKEKRLVNDDLMQTSF
ERMLSLKDLEIEQWHKKHKEKIKQKEKERLRNRNCLELKIKDKEKTKHTPTESKNKELTR
SKSSEVTDAYTKEKQPKDAVSNRSQSVDTKNVMTLGKSSFVSDNSLNRSPRSENEKPGLS
SRSVSMISVASSEDSCHTTVTTPRPPVEYDSDFMLESSESQMSFSQSPFLSIAKSPALHE
RELDSLADLPERIKPPYANRLSTSHLRSSSVEDVKLIISEGRPTIEVRRCSMPSVICEHT
KQFQTISEESNQGSLLTVPGDTSPSPKPEVFSNVPERDLSNVSNIHSSFATSPTGASNSK
YVSADRNLIKNTAPVNTVMDSPVHLEPSSQVGVIQNKSWEMPVDRLETLSTRDFICPNSN
IPDQESSLQSFCNSENKVLKENADFLSLRQTELPGNSCAQDPASFMPPQQPCSFPSQSLS
DAESISKHMSLSYVANQEPGILQQKNAVQIISSALDTDNESTKDTENTFVLGDVQKTDAF
VPVYSDSTIQEASPNFEKAYTLPVLPSEKDFNGSDASTQLNTHYAFSKLTYKSSSGHEVE
NSTTDTQVISHEKENKLESLVLTHLSRCDSDLCEMNAGMPKGNLNEQDPKHCPESEKCLL
SIEDEESQQSILSSLENHSQQSTQPEMHKYGQLVKVELEENAEDDKTENQIPQRMTRNKA
NTMANQSKQILASCTLLSEKDSESSSPRGRIRLTEDDDPQIHHPRKRKVSRVPQPVQVSP
SLLQAKEKTQQSLAAIVDSLKLDEIQPYSSERANPYFEYLHIRKKIEEKRKLLCSVIPQA
PQYYDEYVTFNGSYLLDGNPLSKICIPTITPPPSLSDPLKELFRQQEVVRMKLRLQHSIE
REKLIVSNEQEVLRVHYRAARTLANQTLPFSACTVLLDAEVYNVPLDSQSDDSKTSVRDR
FNARQFMSWLQDVDDKFDKLKTCLLMRQQHEAAALNAVQRLEWQLKLQELDPATYKSISI
YEIQEFYVPLVDVNDDFELTPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UB98	1.000	1.000	0.000	2062	1.000	1.000	Q6UB98.pdb.gz	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
2	AFDB:E9Q4F7	0.125	0.101	6.199E-63	2643	0.383	0.299	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
3	AFDB:Q6UB99	0.120	0.102	2.564E-62	2663	0.384	0.297	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
4	PDB:2dvwA	0.060	0.530	4.666E-10	229	0.020	0.183	2dvwA.pdb.gz
5	PDB:8cs9A	0.061	0.156	1.033E-9	796	0.023	0.059	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
6	AFDB:D3YZU1	0.062	0.059	1.514E-9	2167	0.107	0.102	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
7	PDB:3ehqA	0.055	0.613	1.823E-9	182	0.019	0.220	3ehqA.pdb.gz
8	AFDB:A1Z9K8	0.065	0.071	8.803E-9	1871	0.112	0.123	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
9	PDB:1wg0A	0.062	0.500	9.460E-9	243	0.020	0.169	1wg0A.pdb.gz
10	PDB:6jd6B	0.059	0.593	1.408E-8	192	0.019	0.208	6jd6B.pdb.gz
11	PDB:6mwqA	0.060	0.247	1.767E-8	493	0.025	0.103	6mwqA.pdb.gz
12	AFDB:F1QJ05	0.062	0.084	2.311E-8	1509	0.103	0.141	F1QJ05.pdb.gz
13	PDB:1bd8A	0.048	0.562	9.168E-8	156	0.019	0.256	1bd8A.pdb.gz
14	PDB:6v9hC	0.047	0.224	9.704E-8	270	0.022	0.170	6v9hC.pdb.gz
15	PDB:7df7B	0.053	0.879	1.218E-7	119	0.016	0.269	7df7B.pdb.gz
16	PDB:5vkqA	0.059	0.080	1.289E-7	1499	0.019	0.026	5vkqA.pdb.gz
17	AFDB:Q9JLU4	0.062	0.073	3.952E-7	1740	0.109	0.129	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
18	AFDB:M9NDA1	0.041	0.058	3.830E-6	1230	0.081	0.135	M9NDA1.pdb.gz	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
19	AFDB:F1R0Q7	0.059	0.073	2.494E-5	1631	0.113	0.142	F1R0Q7.pdb.gz
20	AFDB:Q8I1Y8	0.034	0.032	5.523E-5	2271	0.136	0.123	Q8I1Y8.pdb.gz	Q8I1Y8_PLAF7 AP2 domain transcription factor AP2-SP2, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0404100 PE=4 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PG48	0.0	659	330	0.153	0.955	Q6PG48_HUMAN ANKRD12 protein OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=1
2	Q6UB98	0.0	4200	2062	1.000	1.000	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
3	Q6UB99	5.12e-137	481	2663	0.112	0.087	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
4	E9Q4F7	5.19e-134	471	2643	0.109	0.085	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
5	Q59GC3	2.39e-100	332	439	0.100	0.469	Q59GC3_HUMAN Ankyrin repeat domain 11 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
6	X5D778	4.32e-90	302	421	0.066	0.323	X5D778_HUMAN Ankyrin repeat domain 11 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=1
7	Q8IQI3	6.31e-45	177	658	0.051	0.160	Q8IQI3_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10984 PE=1 SV=2
8	A0A2R8Y438	3.28e-34	146	944	0.048	0.104	A0A2R8Y438_HUMAN Ankyrin repeat domain containing 11 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=1
9	Q90X95	1.00e-33	143	772	0.032	0.085	Q90X95_XENLA BRCA1 associated RING domain 1 L homeolog OS=Xenopus laevis OX=8355 GN=bard1.L PE=1 SV=1
10	Q9QZH2	4.75e-32	138	768	0.036	0.096	BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus OX=10116 GN=Bard1 PE=2 SV=1
11	A0AVN2	8.63e-32	137	777	0.032	0.085	A0AVN2_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
12	Q99728	1.17e-31	137	777	0.032	0.085	BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
13	O70445	2.95e-31	135	765	0.032	0.088	BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus OX=10090 GN=Bard1 PE=2 SV=1
14	A0A140LI88	6.40e-25	116	1857	0.027	0.030	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
15	A0A087X2H0	3.66e-24	112	641	0.026	0.083	A0A087X2H0_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
16	Q96HA7	3.52e-22	107	1378	0.023	0.035	TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens OX=9606 GN=TONSL PE=1 SV=2
17	O95271	9.54e-21	102	1327	0.027	0.042	TNKS1_HUMAN Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2
18	Q6PFX9	1.36e-20	102	1320	0.027	0.042	TNKS1_MOUSE Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus musculus OX=10090 GN=Tnks PE=1 SV=1
19	D3Z8Q6	1.47e-20	102	1317	0.027	0.043	D3Z8Q6_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Tnks PE=1 SV=1
20	A0A8I5YBL7	1.66e-20	102	1313	0.027	0.043	A0A8I5YBL7_RAT Poly [ADP-ribose] polymerase OS=Rattus norvegicus OX=10116 GN=Tnks PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.6e-14	64.8	Ankyrin repeat
2	PF12796 Ank_2	2.2e-15	68.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3e-11	53.3	Ankyrin repeat
4	PF13637 Ank_4	3.3e-16	70.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.7e-14	64.9	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262126

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372959	0.834	Leucine-rich repeat-containing protein 30
2	9606.ENSP00000311513	0.829	Remodeling and spacing factor 1
3	9606.ENSP00000349503	0.724	Zinc finger and BTB domain-containing protein 14
4	9606.ENSP00000282516	0.693	Nipped-B-like protein
5	9606.ENSP00000369318	0.684	Rho-related BTB domain-containing protein 3
6	9606.ENSP00000392660	0.678	Rho GTPase-activating protein 28
7	9606.ENSP00000327268	0.660	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
8	9606.ENSP00000307684	0.632	Transcriptional adapter 3
9	9606.ENSP00000316377	0.597	Disks large-associated protein 1
10	9606.ENSP00000418915	0.589	Cyclin-dependent kinase inhibitor 2A
11	9606.ENSP00000461945	0.583	Ras-related protein Rab-31
12	9606.ENSP00000418648	0.576	Ubinuclein-2
13	9606.ENSP00000255608	0.532	BTB/POZ domain-containing protein 2
14	9606.ENSP00000348959	0.507	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
15	9606.ENSP00000369887	0.500	SAFB-like transcription modulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.337	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.965	biological regulation
GO:0050789	0.900	regulation of biological process
GO:0050794	0.643	regulation of cellular process
GO:0008152	0.638	metabolic process
GO:0071704	0.563	organic substance metabolic process
GO:0044238	0.517	primary metabolic process
GO:0019222	0.432	regulation of metabolic process
GO:0043170	0.414	macromolecule metabolic process
GO:0032502	0.395	developmental process
GO:0006807	0.394	nitrogen compound metabolic process
GO:0048856	0.390	anatomical structure development
GO:0060255	0.369	regulation of macromolecule metabolic process
GO:0044237	0.365	cellular metabolic process
GO:0080090	0.359	regulation of primary metabolic process
GO:0032501	0.346	multicellular organismal process
GO:0048519	0.345	negative regulation of biological process
GO:0051171	0.335	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016020	0.424	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]