StarFunc result for job id Q6UVJ0

User Input

>input (657 residues)
MSQVLFHQLVPLQVKCKDCEERRVSIRMSIELQSVSNPVHRKDLVIRLTDDTDPFFLYNL
VISEEDFQSLKFQQGLLVDFLAFPQKFIDLLQQCTQEHAKEIPRFLLQLVSPAAILDNSP
AFLNVVETNPFKHLTHLSLKLLPGNDVEIKKFLAGCLKCSKEEKLSLMQSLDDATKQLDF
TRKTLAEKKQELDKLRNEWASHTAALTNKHSQELTNEKEKALQAQVQYQQQHEQQKKDLE
ILHQQNIHQLQNRLSELEAANKDLTERKYKGDSTIRELKAKLSGVEEELQRTKQEVLSLR
RENSTLDVECHEKEKHVNQLQTKVAVLEQEIKDKDQLVLRTKEAFDTIQEQKVVLEENGE
KNQVQLGKLEATIKSLSAELLKANEIIKKLQGDLKTLMGKLKLKNTVTIQQEKLLAEKEE
KLQKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLITWLNKELNE
NQLVRKQDVLGPSTTPPAHSSSNTIRSGISPNLNVVDGRLTYPTCGIGYPVSSAFAFQNT
FPHSISAKNTSHPGSGTKVQFNLQFTKPNASLGDVQSGATISMPCSTDKENGENVGLESK
YLKKREDSIPLRGLSQNLFSNSDHQRDGTLGALHTSSKPTALPSASSAYFPGQLPNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UVJ0	1.000	1.000	4.769E-83	657	1.000	1.000	Q6UVJ0.pdb.gz	SAS6_HUMAN Spindle assembly abnormal protein 6 homolog OS=Homo sapiens OX=9606 GN=SASS6 PE=1 SV=1
2	AFDB:Q80UK7	0.753	0.756	1.400E-71	654	0.851	0.855	Q80UK7.pdb.gz	SAS6_MOUSE Spindle assembly abnormal protein 6 homolog OS=Mus musculus OX=10090 GN=Sass6 PE=2 SV=2
3	AFDB:Q7ZVT3	0.441	0.459	5.741E-48	627	0.549	0.576	Q7ZVT3.pdb.gz	SAS6_DANRE Spindle assembly abnormal protein 6 homolog OS=Danio rerio OX=7955 GN=sass6 PE=1 SV=1
4	AFDB:Q6NRG6	0.559	0.551	8.479E-48	668	0.539	0.530	Q6NRG6.pdb.gz	SAS6_XENLA Spindle assembly abnormal protein 6 homolog OS=Xenopus laevis OX=8355 GN=sas6 PE=2 SV=1
5	AFDB:A9CQL4	0.423	0.385	5.429E-21	728	0.234	0.212	A9CQL4.pdb.gz	A9CQL4_CHLRE Centriole protein OS=Chlamydomonas reinhardtii OX=3055 GN=CrSAS-6 PE=1 SV=1
6	AFDB:Q38DW1	0.457	0.418	1.400E-20	726	0.190	0.172	Q38DW1.pdb.gz	Q38DW1_TRYB2 Spindle assembly abnormal protein 6 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1930 PE=4 SV=1
7	AFDB:Q9VAC8	0.300	0.409	6.182E-13	472	0.157	0.218	Q9VAC8.pdb.gz	SAS6_DROME Spindle assembly abnormal protein 6 homolog OS=Drosophila melanogaster OX=7227 GN=Sas-6 PE=1 SV=2
8	AFDB:A0A024RAZ1	0.226	0.216	3.541E-4	691	0.148	0.140	A0A024RAZ1.pdb.gz
9	PDB:7lt3F	0.176	0.368	6.190E-4	213	0.040	0.122	7lt3F.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
10	AFDB:Q8N9W4	0.138	0.109	7.725E-4	909	0.140	0.101	Q8N9W4.pdb.gz	GG6L2_HUMAN Golgin subfamily A member 6-like protein 2 OS=Homo sapiens OX=9606 GN=GOLGA6L2 PE=1 SV=3
11	AFDB:F4HRT5	0.170	0.105	1.141E-3	1132	0.123	0.072	F4HRT5.pdb.gz	CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis thaliana OX=3702 GN=CRWN1 PE=1 SV=1
12	PDB:3wtfB	0.138	0.500	6.076E-3	134	0.035	0.172	3wtfB.pdb.gz
13	PDB:7lsyH	0.141	0.326	2.446E-2	223	0.026	0.076	7lsyH.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
14	PDB:3cm1A	0.090	0.319	1.626E-1	137	0.023	0.109	3cm1A.pdb.gz
15	PDB:7qooP	0.062	0.145	2.838E-1	233	0.047	0.133	7qooP.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
16	PDB:6kr6A	0.077	0.071	4.431E-1	713	0.021	0.020	6kr6A.pdb.gz	Crystal structure of Drosophila Piwi.
17	PDB:5lzwii	0.052	0.084	4.685E-1	372	0.026	0.046	5lzwii.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
18	PDB:7n9fv	0.097	0.111	6.544E-1	564	0.078	0.090	7n9fv.pdb.gz
19	PDB:5wviU	0.063	0.113	8.178E-1	282	0.037	0.085	5wviU.pdb.gz	High-resolution cryo-EM structure of the proteasome in complex with ADP-AlFx
20	PDB:7vg3A	0.052	0.042	8.646E-1	860	0.026	0.020	7vg3A.pdb.gz	Mechanism of siRNA production by a plant Dicer-RNA complex in dicing-competent conformation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NRG6	0.0	632	668	0.546	0.537	SAS6_XENLA Spindle assembly abnormal protein 6 homolog OS=Xenopus laevis OX=8355 GN=sas6 PE=2 SV=1
2	Q6UVJ0	0.0	1332	657	1.000	1.000	SAS6_HUMAN Spindle assembly abnormal protein 6 homolog OS=Homo sapiens OX=9606 GN=SASS6 PE=1 SV=1
3	Q7ZVT3	0.0	678	627	0.554	0.581	SAS6_DANRE Spindle assembly abnormal protein 6 homolog OS=Danio rerio OX=7955 GN=sass6 PE=1 SV=1
4	Q80UK7	0.0	1096	654	0.851	0.855	SAS6_MOUSE Spindle assembly abnormal protein 6 homolog OS=Mus musculus OX=10090 GN=Sass6 PE=2 SV=2
5	A9CQL4	5.10e-56	204	728	0.239	0.216	A9CQL4_CHLRE Centriole protein OS=Chlamydomonas reinhardtii OX=3055 GN=CrSAS-6 PE=1 SV=1
6	Q38DW1	1.40e-17	89.4	726	0.207	0.187	Q38DW1_TRYB2 Spindle assembly abnormal protein 6 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1930 PE=4 SV=1
7	Q9VAC8	3.77e-11	68.2	472	0.174	0.242	SAS6_DROME Spindle assembly abnormal protein 6 homolog OS=Drosophila melanogaster OX=7227 GN=Sas-6 PE=1 SV=2
8	Q9USI6	3.13e-04	46.6	1526	0.107	0.046	MYO2_SCHPO Myosin type-2 heavy chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo2 PE=1 SV=1
9	A0A8I6AM56	0.010	41.6	1246	0.111	0.059	A0A8I6AM56_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
10	Q8BSS9	0.010	41.6	1257	0.111	0.058	LIPA2_MOUSE Liprin-alpha-2 OS=Mus musculus OX=10090 GN=Ppfia2 PE=1 SV=2
11	F1M8A4	0.011	41.6	1126	0.111	0.065	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
12	O75334	0.011	41.6	1257	0.113	0.059	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
13	Q9UBC2	0.012	41.2	864	0.068	0.052	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
14	P42566	0.016	40.8	896	0.081	0.059	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
15	Q54KI4	0.020	40.8	1196	0.055	0.030	EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum OX=44689 GN=eps15 PE=1 SV=1
16	Q4L180	0.032	40.0	1135	0.090	0.052	FIL1L_HUMAN Filamin A-interacting protein 1-like OS=Homo sapiens OX=9606 GN=FILIP1L PE=1 SV=2
17	E9Q3P4	0.038	40.0	2997	0.091	0.020	E9Q3P4_MOUSE Centromere protein F OS=Mus musculus OX=10090 GN=Cenpf PE=1 SV=1
18	Q9QZ84	0.057	39.3	2473	0.091	0.024	Q9QZ84_MOUSE LEK1 (Fragment) OS=Mus musculus OX=10090 GN=Cenpf PE=2 SV=1
19	Q8S2T0	0.075	38.9	788	0.088	0.074	GRIP_ARATH Protein GRIP OS=Arabidopsis thaliana OX=3702 GN=GRIP PE=1 SV=2
20	Q155P7	0.080	38.9	2997	0.091	0.020	Q155P7_MOUSE LEK1 OS=Mus musculus OX=10090 GN=Cenpf PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07888 CALCOCO1	8.9	16.7	Calcium binding and coiled-coil domain (CALCOCO1) like
2	PF16531 SAS-6_N	2.5e-23	93.6	Centriolar protein SAS N-terminal
3	PF18594 Sas6_CC	0.00046	31.2	Sas6/XLF/XRCC4 coiled-coil domain
4	PF03549 Tir_receptor_M	1.3e+02	14.3	Translocated intimin receptor (Tir) intimin-binding domain
5	PF12718 Tropomyosin_1	3.3	19.3	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287482

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371308	0.996	Centromere protein J
2	9606.ENSP00000257287	0.994	Centrosomal protein of 135 kDa
3	9606.ENSP00000360944	0.988	SCL-interrupting locus protein
4	9606.ENSP00000270861	0.979	Serine/threonine-protein kinase PLK4
5	9606.ENSP00000370337	0.956	Centrosomal protein of 152 kDa
6	9606.ENSP00000370803	0.933	Centriolar coiled-coil protein of 110 kDa
7	9606.ENSP00000343818	0.873	CDK5 regulatory subunit-associated protein 2
8	9606.ENSP00000352572	0.852	Pericentrin
9	9606.ENSP00000316681	0.843	Centrosomal protein of 295 kDa
10	9606.ENSP00000336524	0.824	Centrosomal protein of 63 kDa
11	9606.ENSP00000255674	0.799	Rotatin
12	9606.ENSP00000251413	0.798	Tubulin gamma-1 chain
13	9606.ENSP00000300093	0.795	Serine/threonine-protein kinase PLK1
14	9606.ENSP00000427550	0.782	Centrosomal protein of 192 kDa
15	9606.ENSP00000342510	0.776	Centrosomal protein of 97 kDa
16	9606.ENSP00000362021	0.772	Transmembrane protein 35A
17	9606.ENSP00000410216	0.771	Centrosomal protein POC5
18	9606.ENSP00000298050	0.749	Deuterosome assembly protein 1
19	9606.ENSP00000313034	0.747	F-box/WD repeat-containing protein 5
20	9606.ENSP00000359300	0.746	Centrin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0010564	0.994	regulation of cell cycle process
GO:0033043	0.993	regulation of organelle organization
GO:0006996	0.990	organelle organization
GO:0044087	0.989	regulation of cellular component biogenesis
GO:0048522	0.987	positive regulation of cellular process
GO:0051298	0.981	centrosome duplication
GO:0032886	0.980	regulation of microtubule-based process
GO:1901990	0.979	regulation of mitotic cell cycle phase transition
GO:0090068	0.974	positive regulation of cell cycle process
GO:1902115	0.960	regulation of organelle assembly
GO:0010638	0.958	positive regulation of organelle organization
GO:1901992	0.956	positive regulation of mitotic cell cycle phase transition
GO:2000045	0.955	regulation of G1/S transition of mitotic cell cycle
GO:0046605	0.950	regulation of centrosome cycle
GO:1900087	0.945	positive regulation of G1/S transition of mitotic cell cycle
GO:0051493	0.944	regulation of cytoskeleton organization
GO:0140694	0.941	non-membrane-bounded organelle assembly
GO:0044089	0.939	positive regulation of cellular component biogenesis
GO:0010824	0.934	regulation of centrosome duplication
GO:0098534	0.926	centriole assembly
GO:0007099	0.918	centriole replication
GO:1902117	0.890	positive regulation of organelle assembly
GO:0051495	0.828	positive regulation of cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005815	0.997	microtubule organizing center
GO:0005814	0.978	centriole
GO:0032991	0.952	protein-containing complex
GO:0005737	0.944	cytoplasm
GO:0005813	0.932	centrosome
GO:0043227	0.771	membrane-bounded organelle
GO:0043231	0.468	intracellular membrane-bounded organelle
GO:0005829	0.460	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]