StarFunc result for job id Q6UVK1

User Input

>input (2322 residues)
MQSGPRPPLPAPGLALALTLTMLARLASAASFFGENHLEVPVATALTDIDLQLQFSTSQP
EALLLLAAGPADHLLLQLYSGRLQVRLVLGQEELRLQTPAETLLSDSIPHTVVLTVVEGW
ATLSVDGFLNASSAVPGAPLEVPYGLFVGGTGTLGLPYLRGTSRPLRGCLHAATLNGRSL
LRPLTPDVHEGCAEEFSASDDVALGFSGPHSLAAFPAWGTQDEGTLEFTLTTQSRQAPLA
FQAGGRRGDFIYVDIFEGHLRAVVEKGQGTVLLHNSVPVADGQPHEVSVHINAHRLEISV
DQYPTHTSNRGVLSYLEPRGSLLLGGLDAEASRHLQEHRLGLTPEATNASLLGCMEDLSV
NGQRRGLREALLTRNMAAGCRLEEEEYEDDAYGHYEAFSTLAPEAWPAMELPEPCVPEPG
LPPVFANFTQLLTISPLVVAEGGTAWLEWRHVQPTLDLMEAELRKSQVLFSVTRGARHGE
LELDIPGAQARKMFTLLDVVNRKARFIHDGSEDTSDQLVLEVSVTARVPMPSCLRRGQTY
LLPIQVNPVNDPPHIIFPHGSLMVILEHTQKPLGPEVFQAYDPDSACEGLTFQVLGTSSG
LPVERRDQPGEPATEFSCRELEAGSLVYVHRGGPAQDLTFRVSDGLQASPPATLKVVAIR
PAIQIHRSTGLRLAQGSAMPILPANLSVETNAVGQDVSVLFRVTGALQFGELQKQGAGGV
EGAEWWATQAFHQRDVEQGRVRYLSTDPQHHAYDTVENLALEVQVGQEILSNLSFPVTIQ
RATVWMLRLEPLHTQNTQQETLTTAHLEATLEEAGPSPPTFHYEVVQAPRKGNLQLQGTR
LSDGQGFTQDDIQAGRVTYGATARASEAVEDTFRFRVTAPPYFSPLYTFPIHIGGDPDAP
VLTNVLLVVPEGGEGVLSADHLFVKSLNSASYLYEVMERPRHGRLAWRGTQDKTTMVTSF
TNEDLLRGRLVYQHDDSETTEDDIPFVATRQGESSGDMAWEEVRGVFRVAIQPVNDHAPV
QTISRIFHVARGGRRLLTTDDVAFSDADSGFADAQLVLTRKDLLFGSIVAVDEPTRPIYR
FTQEDLRKRRVLFVHSGADRGWIQLQVSDGQHQATALLEVQASEPYLRVANGSSLVVPQG
GQGTIDTAVLHLDTNLDIRSGDEVHYHVTAGPRWGQLVRAGQPATAFSQQDLLDGAVLYS
HNGSLSPRDTMAFSVEAGPVHTDATLQVTIALEGPLAPLKLVRHKKIYVFQGEAAEIRRD
QLEAAQEAVPPADIVFSVKSPPSAGYLVMVSRGALADEPPSLDPVQSFSQEAVDTGRVLY
LHSRPEAWSDAFSLDVASGLGAPLEGVLVELEVLPAAIPLEAQNFSVPEGGSLTLAPPLL
RVSGPYFPTLLGLSLQVLEPPQHGALQKEDGPQARTLSAFSWRMVEEQLIRYVHDGSETL
TDSFVLMANASEMDRQSHPVAFTVTVLPVNDQPPILTTNTGLQMWEGATAPIPAEALRST
DGDSGSEDLVYTIEQPSNGRVVLRGAPGTEVRSFTQAQLDGGLVLFSHRGTLDGGFRFRL
SDGEHTSPGHFFRVTAQKQVLLSLKGSQTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLY
RVVRGPQLGRLFHAQQDSTGEALVNFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSS
PPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSP
QRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHF
RAHLQGPAGASVAGPQTSEAFAITVRDVNERPPQPQASVPLRLTRGSRAPISRAQLSVVD
PDSAPGEIEYEVQRAPHNGFLSLVGGGLGPVTRFTQADVDSGRLAFVANGSSVAGIFQLS
MSDGASPPLPMSLAVDILPSAIEVQLRAPLEVPQALGRSSLSQQQLRVVSDREEPEAAYR
LIQGPQYGHLLVGGRPTSAFSQFQIDQGEVVFAFTNFSSSHDHFRVLALARGVNASAVVN
VTVRALLHVWAGGPWPQGATLRLDPTVLDAGELANRTGSVPRFRLLEGPRHGRVVRVPRA
RTEPGGSQLVEQFTQQDLEDGRLGLEVGRPEGRAPGPAGDSLTLELWAQGVPPAVASLDF
ATEPYNAARPYSVALLSVPEAARTEAGKPESSTPTGEPGPMASSPEPAVAKGGFLSFLEA
NMFSVIIPMCLVLLLLALILPLLFYLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEP
GQAIPLTAVPGQGPPPGGQPDPELLQFCRTPNPALKNGQYWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UVK1	1.000	1.000	0.000	2322	1.000	1.000	Q6UVK1.pdb.gz	CSPG4_HUMAN Chondroitin sulfate proteoglycan 4 OS=Homo sapiens OX=9606 GN=CSPG4 PE=1 SV=2
2	AFDB:Q8VHY0	0.264	0.264	0.000	2327	0.835	0.833	Q8VHY0.pdb.gz	CSPG4_MOUSE Chondroitin sulfate proteoglycan 4 OS=Mus musculus OX=10090 GN=Cspg4 PE=1 SV=3
3	AFDB:Q9VJ82	0.151	0.148	0.000	2381	0.236	0.230	Q9VJ82.pdb.gz	Q9VJ82_DROME Kon-tiki, isoform B OS=Drosophila melanogaster OX=7227 GN=kon PE=4 SV=3
4	AFDB:Q684R7	0.154	0.160	6.796E-100	2191	0.175	0.185	Q684R7.pdb.gz	FREM1_MOUSE FRAS1-related extracellular matrix protein 1 OS=Mus musculus OX=10090 GN=Frem1 PE=1 SV=1
5	AFDB:F1NY98	0.094	0.101	8.194E-35	2034	0.078	0.089	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
6	AFDB:A0A2R8QL08	0.083	0.088	8.844E-33	2036	0.087	0.100	A0A2R8QL08.pdb.gz
7	AFDB:Q9VAF5	0.073	0.095	6.621E-32	1706	0.090	0.122	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
8	AFDB:Q0ZM14	0.111	0.124	6.878E-31	1899	0.087	0.106	Q0ZM14.pdb.gz	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
9	AFDB:Q6ZU64	0.072	0.083	3.321E-28	1925	0.076	0.091	Q6ZU64.pdb.gz	CFA65_HUMAN Cilia- and flagella-associated protein 65 OS=Homo sapiens OX=9606 GN=CFAP65 PE=1 SV=2
10	AFDB:B7ZD56	0.088	0.113	4.452E-24	1670	0.076	0.106	B7ZD56.pdb.gz
11	PDB:7sqcO0	0.071	0.105	1.146E-21	1140	0.050	0.101	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:5a42A	0.061	0.082	1.351E-13	1597	0.060	0.087	5a42A.pdb.gz
13	PDB:4aq1A	0.057	0.141	1.541E-12	721	0.041	0.133	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:7q5zA	0.070	0.105	2.461E-12	1344	0.047	0.081	7q5zA.pdb.gz
15	PDB:7q1yA	0.065	0.092	5.717E-12	1374	0.050	0.084	7q1yA.pdb.gz
16	PDB:5oj2B	0.081	0.207	7.224E-12	692	0.042	0.140	5oj2B.pdb.gz
17	PDB:7nycA	0.059	0.077	1.051E-11	1542	0.041	0.062	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:7vonA	0.066	0.094	1.328E-11	1399	0.044	0.074	7vonA.pdb.gz
19	PDB:1e07A	0.066	0.154	2.329E-11	642	0.035	0.126	1e07A.pdb.gz
20	PDB:4ziqA	0.068	0.096	1.042E-10	1450	0.058	0.093	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00657	0.0	3792	2326	0.827	0.826	CSPG4_RAT Chondroitin sulfate proteoglycan 4 OS=Rattus norvegicus OX=10116 GN=Cspg4 PE=1 SV=2
2	Q6UVK1	0.0	4666	2322	1.000	1.000	CSPG4_HUMAN Chondroitin sulfate proteoglycan 4 OS=Homo sapiens OX=9606 GN=CSPG4 PE=1 SV=2
3	Q8VHY0	0.0	3804	2327	0.829	0.827	CSPG4_MOUSE Chondroitin sulfate proteoglycan 4 OS=Mus musculus OX=10090 GN=Cspg4 PE=1 SV=3
4	Q9VJ82	2.54e-174	595	2381	0.240	0.234	Q9VJ82_DROME Kon-tiki, isoform B OS=Drosophila melanogaster OX=7227 GN=kon PE=4 SV=3
5	A3RLX3	1.24e-173	593	2381	0.239	0.234	A3RLX3_DROME Kon-tiki OS=Drosophila melanogaster OX=7227 GN=Kon PE=1 SV=1
6	P0C091	6.29e-52	206	2139	0.106	0.115	FREM3_HUMAN FRAS1-related extracellular matrix protein 3 OS=Homo sapiens OX=9606 GN=FREM3 PE=3 SV=2
7	D7PS91	1.72e-51	204	3119	0.158	0.117	D7PS91_DANRE FRAS1-related extracellular matrix 2a OS=Danio rerio OX=7955 GN=bla PE=1 SV=1
8	B6IDE6	2.29e-51	204	3113	0.158	0.118	B6IDE6_DANRE FRAS1-related extracellular matrix protein 2 precursor OS=Danio rerio OX=7955 GN=bla PE=1 SV=1
9	Q684R7	4.69e-50	199	2191	0.146	0.155	FREM1_MOUSE FRAS1-related extracellular matrix protein 1 OS=Mus musculus OX=10090 GN=Frem1 PE=1 SV=1
10	Q5H8C1	1.81e-48	194	2179	0.145	0.155	FREM1_HUMAN FRAS1-related extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=FREM1 PE=1 SV=3
11	Q5SZK8	1.43e-47	191	3169	0.164	0.120	FREM2_HUMAN FRAS1-related extracellular matrix protein 2 OS=Homo sapiens OX=9606 GN=FREM2 PE=1 SV=3
12	D7PS89	8.09e-46	185	2167	0.149	0.160	D7PS89_DANRE FRAS1-related extracellular matrix protein 1 precursor OS=Danio rerio OX=7955 GN=rfl PE=2 SV=1
13	Q6NVD0	1.39e-44	182	3160	0.103	0.076	FREM2_MOUSE FRAS1-related extracellular matrix protein 2 OS=Mus musculus OX=10090 GN=Frem2 PE=1 SV=2
14	Q80T14	6.44e-42	173	4010	0.148	0.086	FRAS1_MOUSE Extracellular matrix organizing protein FRAS1 OS=Mus musculus OX=10090 GN=Fras1 PE=1 SV=2
15	F1Q633	1.27e-37	159	3970	0.140	0.082	F1Q633_DANRE Extracellular matrix protein FRAS1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=1
16	A0A0R4IQJ3	1.37e-37	159	4003	0.140	0.081	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
17	Q5H8B9	5.18e-33	143	2123	0.129	0.141	FREM3_MOUSE FRAS1-related extracellular matrix protein 3 OS=Mus musculus OX=10090 GN=Frem3 PE=2 SV=2
18	Q960X3	1.87e-19	97.1	514	0.046	0.208	Q960X3_DROME LD31354p OS=Drosophila melanogaster OX=7227 GN=kon PE=2 SV=1
19	A0A1D5RMU6	1.88e-12	75.9	1499	0.038	0.059	A0A1D5RMU6_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
20	A0A0R4J2G7	2.03e-12	75.9	1495	0.038	0.060	A0A0R4J2G7_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16184 Cadherin_3	2.6e-215	711.6	Cadherin-like
2	PF17803 Cadherin_4	0.032	26.2	Bacterial cadherin-like domain
3	PF11857 DUF3377	7.8e+02	11.4	Domain of unknown function (DUF3377)
4	PF14804 Jag_N	1.3e+02	14.3	Jag N-terminus
5	PF00054 Laminin_G_1	1.9e-25	101.0	Laminin G domain
6	PF02210 Laminin_G_2	1e-32	124.8	Laminin G domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312506

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286614	0.953	Matrix metalloproteinase-16
2	9606.ENSP00000379350	0.950	Integrin beta-1
3	9606.ENSP00000264039	0.948	Glypican-1
4	9606.ENSP00000363827	0.948	Basement membrane-specific heparan sulfate proteoglycan core protein
5	9606.ENSP00000305725	0.935	Carbohydrate sulfotransferase 11
6	9606.ENSP00000366246	0.934	Glypican-6
7	9606.ENSP00000292377	0.932	Glypican-2
8	9606.ENSP00000254190	0.930	Chondroitin sulfate synthase 1
9	9606.ENSP00000359864	0.930	Glypican-4
10	9606.ENSP00000361818	0.930	Syndecan-4
11	9606.ENSP00000368678	0.930	Agrin
12	9606.ENSP00000243776	0.929	Chondroitin sulfate synthase 2
13	9606.ENSP00000362207	0.929	Carbohydrate sulfotransferase 3
14	9606.ENSP00000370542	0.929	Syndecan-1
15	9606.ENSP00000307046	0.927	Syndecan-2
16	9606.ENSP00000377836	0.927	Glypican-3
17	9606.ENSP00000007722	0.926	Integrin alpha-3
18	9606.ENSP00000366267	0.923	Glypican-5
19	9606.ENSP00000317404	0.919	Carbohydrate sulfotransferase 13
20	9606.ENSP00000310565	0.917	Dermatan-sulfate epimerase-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.927	enzyme binding
GO:0019901	0.921	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.995	biological regulation
GO:0050794	0.989	regulation of cellular process
GO:0048856	0.971	anatomical structure development
GO:0032501	0.966	multicellular organismal process
GO:0050896	0.964	response to stimulus
GO:0007275	0.958	multicellular organism development
GO:0048731	0.941	system development
GO:0048518	0.919	positive regulation of biological process
GO:0030154	0.919	cell differentiation
GO:0048522	0.904	positive regulation of cellular process
GO:0007154	0.899	cell communication
GO:0051716	0.893	cellular response to stimulus
GO:0023052	0.886	signaling
GO:0007165	0.873	signal transduction
GO:0042325	0.771	regulation of phosphorylation
GO:0007399	0.768	nervous system development
GO:0009893	0.718	positive regulation of metabolic process
GO:0060255	0.708	regulation of macromolecule metabolic process
GO:0080090	0.683	regulation of primary metabolic process
GO:0051171	0.683	regulation of nitrogen compound metabolic process
GO:0031399	0.674	regulation of protein modification process
GO:0010562	0.658	positive regulation of phosphorus metabolic process
GO:0045937	0.641	positive regulation of phosphate metabolic process
GO:0050730	0.609	regulation of peptidyl-tyrosine phosphorylation
GO:0042327	0.602	positive regulation of phosphorylation
GO:0022008	0.541	neurogenesis
GO:0010604	0.527	positive regulation of macromolecule metabolic process
GO:0051173	0.503	positive regulation of nitrogen compound metabolic process
GO:0048583	0.474	regulation of response to stimulus
GO:0051247	0.432	positive regulation of protein metabolic process
GO:0031401	0.413	positive regulation of protein modification process
GO:0001934	0.371	positive regulation of protein phosphorylation
GO:0007166	0.357	cell surface receptor signaling pathway
GO:0048519	0.313	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.993	membrane-bounded organelle
GO:0005576	0.992	extracellular region
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0005737	0.970	cytoplasm
GO:0012505	0.969	endomembrane system
GO:0070062	0.968	extracellular exosome
GO:0043233	0.956	organelle lumen
GO:0070013	0.942	intracellular organelle lumen
GO:0005654	0.909	nucleoplasm
GO:0031012	0.887	extracellular matrix
GO:0062023	0.882	collagen-containing extracellular matrix
GO:0005794	0.748	Golgi apparatus
GO:0030054	0.664	cell junction
GO:0070161	0.626	anchoring junction
GO:0000323	0.621	lytic vacuole
GO:0005764	0.608	lysosome
GO:0005775	0.581	vacuolar lumen
GO:0043202	0.574	lysosomal lumen
GO:0030055	0.564	cell-substrate junction
GO:0005925	0.507	focal adhesion
GO:0005796	0.504	Golgi lumen
GO:0009986	0.402	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]