StarFunc result for job id Q6UVM3

User Input

>input (1135 residues)
MVDLESEVPPLPPRYRFRDLLLGDQGWQNDDRVQVEFYMNENTFKERLKLFFIKNQRSSL
RIRLFNFSLKLLSCLLYIIRVLLENPSQGNEWSHIFWVNRSLPLWGLQVSVALISLFETI
LLGYLSYKGNIWEQILRIPFILEIINAVPFIISIFWPSLRNLFVPVFLNCWLAKHALENM
INDLHRAIQRTQSAMFNQVLILISTLLCLIFTCICGIQHLERIGKKLNLFDSLYFCIVTF
STVGFGDVTPETWSSKLFVVAMICVALVVLPIQFEQLAYLWMERQKSGGNYSRHRAQTEK
HVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVLQIPMWSQRVIYL
QGSALKDQDLLRAKMDDAEACFILSSRCEVDRTSSDHQTILRAWAVKDFAPNCPLYVQIL
KPENKFHIKFADHVVCEEEFKYAMLALNCICPATSTLITLLVHTSRGQEGQQSPEQWQKM
YGRCSGNEVYHIVLEESTFFAEYEGKSFTYASFHAHKKFGVCLIGVRREDNKNILLNPGP
RYIMNSTDICFYINITKEENSAFKNQDQQRKSNVSRSFYHGPSRLPVHSIIASMGTVAID
LQDTSCRSASGPTLSLPTEGSKEIRRPSIAPVLEVADTSSIQTCDLLSDQSEDETTPDEE
MSSNLEYAKGYPPYSPYIGSSPTFCHLLHEKVPFCCLRLDKSCQHNYYEDAKAYGFKNKL
IIVAAETAGNGLYNFIVPLRAYYRPKKELNPIVLLLDNPPDMHFLDAICWFPMVYYMVGS
IDNLDDLLRCGVTFAANMVVVDKESTMSAEEDYMADAKTIVNVQTLFRLFSSLSIITELT
HPANMRFMQFRAKDCYSLALSKLEKKERERGSNLAFMFRLPFAAGRVFSISMLDTLLYQS
FVKDYMISITRLLLGLDTTPGSGFLCSMKITADDLWIRTYARLYQKLCSSTGDVPIGIYR
TESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSDHPLLRRKSMQWARR
LSRKGPKHSGKTAEKITQQRLNLYRRSERQELAELVKNRMKHLGLSTVGYDEMNDHQSTL
SYILINPSPDTRIELNDVVYLIRPDPLAYLPNSEPSRRNSICNVTGQDSREETQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8DY93	0.778	0.477	0.000	1878	0.558	0.337	A8DY93.pdb.gz	A8DY93_DROME Slowpoke 2, isoform D OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=2
2	AFDB:Q6UVM4	0.933	0.927	0.000	1142	0.975	0.969	Q6UVM4.pdb.gz	KCNT2_RAT Potassium channel subfamily T member 2 OS=Rattus norvegicus OX=10116 GN=Kcnt2 PE=1 SV=1
3	AFDB:Q9Z258	0.874	0.805	0.000	1237	0.759	0.696	Q9Z258.pdb.gz	KCNT1_RAT Potassium channel subfamily T member 1 OS=Rattus norvegicus OX=10116 GN=Kcnt1 PE=1 SV=1
4	AFDB:H9G2R4	0.613	0.608	9.569E-98	1143	0.419	0.416	H9G2R4.pdb.gz	H9G2R4_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
5	AFDB:H8ESD6	0.578	0.573	1.562E-43	1146	0.184	0.182	H8ESD6.pdb.gz	H8ESD6_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
6	AFDB:Q12791	0.559	0.517	1.802E-43	1236	0.185	0.170	Q12791.pdb.gz	KCMA1_HUMAN Calcium-activated potassium channel subunit alpha-1 OS=Homo sapiens OX=9606 GN=KCNMA1 PE=1 SV=2
7	AFDB:H7BRC9	0.585	0.574	4.257E-43	1160	0.185	0.181	H7BRC9.pdb.gz	H7BRC9_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
8	AFDB:F1QYL4	0.574	0.544	4.465E-43	1205	0.181	0.170	F1QYL4.pdb.gz	F1QYL4_DANRE BK channel OS=Danio rerio OX=7955 GN=kcnma1 PE=3 SV=3
9	AFDB:O54982	0.573	0.579	1.339E-42	1121	0.170	0.172	O54982.pdb.gz	KCNU1_MOUSE Potassium channel subfamily U member 1 OS=Mus musculus OX=10090 GN=Kcnu1 PE=1 SV=2
10	AFDB:Q28204	0.558	0.545	1.148E-41	1166	0.184	0.179	Q28204.pdb.gz	KCMA1_BOVIN Calcium-activated potassium channel subunit alpha-1 OS=Bos taurus OX=9913 GN=KCNMA1 PE=1 SV=2
11	PDB:7pxeA	0.545	0.678	1.179E-35	885	0.161	0.207	7pxeA.pdb.gz	Small molecule modulation of the Drosophila Slo channel elucidated by cryo-EM.
12	PDB:6u68A	0.193	0.534	3.892E-12	319	0.061	0.216	6u68A.pdb.gz
13	PDB:3rbzA	0.210	0.700	4.890E-11	289	0.063	0.246	3rbzA.pdb.gz	Structures of multiple Ca2+-binding sites in a K+ channel RCK domain
14	PDB:7f3fA	0.111	0.236	1.035E-4	460	0.031	0.076	7f3fA.pdb.gz
15	PDB:7w6sB	0.113	0.243	1.252E-4	448	0.040	0.100	7w6sB.pdb.gz
16	PDB:7phhA	0.116	0.278	1.590E-4	396	0.044	0.126	7phhA.pdb.gz
17	PDB:7sizB	0.111	0.313	2.564E-4	334	0.037	0.126	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
18	PDB:3lutB	0.094	0.205	6.989E-4	390	0.034	0.100	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
19	PDB:5b04C	0.082	0.223	8.873E-4	349	0.033	0.109	5b04C.pdb.gz
20	PDB:7rhsD	0.150	0.335	1.127E-3	441	0.057	0.147	7rhsD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4JD38	768	1788	0.312	0.198	A0A0B4JD38_DROME Slowpoke 2, isoform F OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
2	A0A0B4K738	790	1438	0.323	0.255	A0A0B4K738_DROME Slowpoke 2, isoform H OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
3	A0A0B4KEJ9	791	1727	0.323	0.213	A0A0B4KEJ9_DROME Slowpoke 2, isoform O OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
4	A0A0B4KEQ3	791	1742	0.323	0.211	A0A0B4KEQ3_DROME Slowpoke 2, isoform I OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
5	A0A0B4KF87	768	1732	0.312	0.204	A0A0B4KF87_DROME Slowpoke 2, isoform N OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
6	A0A0B4KFK3	766	1624	0.314	0.219	A0A0B4KFK3_DROME Slowpoke 2, isoform L OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
7	A0A0C4DHC4	791	1707	0.323	0.215	A0A0C4DHC4_DROME Slowpoke 2, isoform G OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=1
8	A8DY93	771	1878	0.313	0.189	A8DY93_DROME Slowpoke 2, isoform D OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=2
9	A8DY94	771	1774	0.313	0.200	A8DY94_DROME Slowpoke 2, isoform E OS=Drosophila melanogaster OX=7227 GN=SLO2 PE=4 SV=2
10	B2MZB8	876	1116	0.420	0.427	B2MZB8_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
11	G5ECD1	875	1119	0.419	0.425	G5ECD1_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
12	G5EDJ1	879	1107	0.423	0.434	G5EDJ1_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
13	H9G2R3	879	1125	0.422	0.426	H9G2R3_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
14	H9G2R4	879	1143	0.422	0.419	H9G2R4_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
15	H9G2R6	880	1140	0.422	0.420	H9G2R6_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
16	H9G2R7	879	1130	0.423	0.425	H9G2R7_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
17	Q565B7	878	1086	0.430	0.449	Q565B7_CAEEL Ion_trans_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slo-2 PE=1 SV=1
18	Q6UVM3	2365	1135	1.000	1.000	KCNT2_HUMAN Potassium channel subfamily T member 2 OS=Homo sapiens OX=9606 GN=KCNT2 PE=1 SV=1
19	Q6UVM4	2308	1142	0.975	0.969	KCNT2_RAT Potassium channel subfamily T member 2 OS=Rattus norvegicus OX=10116 GN=Kcnt2 PE=1 SV=1
20	Q9Z258	1743	1237	0.758	0.695	KCNT1_RAT Potassium channel subfamily T member 1 OS=Rattus norvegicus OX=10116 GN=Kcnt1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10731 Anophelin	1.7e+02	13.5	Thrombin inhibitor from mosquito
2	PF03493 BK_channel_a	1.1e-25	101.1	Calcium-activated BK potassium channel alpha subunit
3	PF06241 Castor_Poll_mid	4.7e+02	12.2	Castor and Pollux, part of voltage-gated ion channel
4	PF00520 Ion_trans	6.2e+02	11.0	Ion transport protein
5	PF07885 Ion_trans_2	5.2e-11	53.7	Ion channel
6	PF02254 TrkA_N	6.2e+02	12.1	TrkA-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294725

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384193	0.781	Cell adhesion molecule 2
2	9606.ENSP00000433757	0.779	Tetratricopeptide repeat domain containing
3	9606.ENSP00000477352	0.768	Short coiled-coil protein
4	9606.ENSP00000293970	0.686	TBC1 domain family member 24
5	9606.ENSP00000383105	0.660	GATOR complex protein DEPDC5
6	9606.ENSP00000400932	0.659	Solute carrier family 35 member G1
7	9606.ENSP00000476519	0.644	Small conductance calcium-activated potassium channel protein 1
8	9606.ENSP00000387694	0.634	Solute carrier family 12 member 5
9	9606.ENSP00000455547	0.619	Uncharacterized protein
10	9606.ENSP00000280756	0.608	Transmembrane protein 263
11	9606.ENSP00000322020	0.594	Mitochondrial glutamate carrier 1
12	9606.ENSP00000427120	0.583	Small conductance calcium-activated potassium channel protein 2
13	9606.ENSP00000262888	0.558	Intermediate conductance calcium-activated potassium channel protein 4
14	9606.ENSP00000346534	0.546	Sodium channel protein type 8 subunit alpha
15	9606.ENSP00000481848	0.544	Small conductance calcium-activated potassium channel protein 3
16	9606.ENSP00000328511	0.514	Potassium voltage-gated channel subfamily A member 4
17	9606.ENSP00000430733	0.514	CUB and sushi domain-containing protein 1
18	9606.ENSP00000284240	0.508	Thy-1 membrane glycoprotein
19	9606.ENSP00000340975	0.503	Ankyrin repeat domain-containing protein SOWAHD
20	9606.ENSP00000304822	0.502	Kappa-casein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022839	0.999	monoatomic ion gated channel activity
GO:0005267	0.999	potassium channel activity
GO:0005488	0.963	binding
GO:0015103	0.849	inorganic anion transmembrane transporter activity
GO:0008509	0.847	monoatomic anion transmembrane transporter activity
GO:0005515	0.836	protein binding
GO:0005228	0.740	intracellular sodium activated potassium channel activity
GO:0015108	0.624	chloride transmembrane transporter activity
GO:0005254	0.611	chloride channel activity
GO:0005244	0.327	voltage-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0098660	0.990	inorganic ion transmembrane transport
GO:0006811	0.986	monoatomic ion transport
GO:0030001	0.981	metal ion transport
GO:0071805	0.965	potassium ion transmembrane transport
GO:0140115	0.929	export across plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.985	plasma membrane
GO:0005622	0.394	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.999	K(+)(in) = K(+)(out)
RHEA:29823	0.624	chloride(in) = chloride(out)

[back to server]