StarFunc result for job id Q6UW56

User Input

>input (229 residues)
MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELML
HARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQ
TLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQ
CVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UW56	1.000	1.000	1.195E-49	229	1.000	1.000	Q6UW56.pdb.gz	ARAID_HUMAN All-trans retinoic acid-induced differentiation factor OS=Homo sapiens OX=9606 GN=ATRAID PE=1 SV=2
2	AFDB:Q6PGD0	0.904	0.928	8.772E-40	223	0.769	0.789	Q6PGD0.pdb.gz	ARAID_MOUSE All-trans retinoic acid-induced differentiation factor OS=Mus musculus OX=10090 GN=Atraid PE=1 SV=2
3	AFDB:O94813	0.208	0.039	1.358E-2	1529	0.153	0.023	O94813.pdb.gz	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
4	AFDB:Q383W7	0.276	0.097	1.358E-2	764	0.087	0.026	Q383W7.pdb.gz	Q383W7_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1380 PE=4 SV=1
5	AFDB:Q96HD1	0.157	0.100	1.358E-2	420	0.074	0.040	Q96HD1.pdb.gz	CREL1_HUMAN Protein disulfide isomerase CRELD1 OS=Homo sapiens OX=9606 GN=CRELD1 PE=1 SV=3
6	AFDB:B8A498	0.235	0.043	1.543E-2	1524	0.162	0.024	B8A498.pdb.gz
7	AFDB:Q8VHS2	0.199	0.046	1.543E-2	1405	0.100	0.016	Q8VHS2.pdb.gz	CRUM1_MOUSE Protein crumbs homolog 1 OS=Mus musculus OX=10090 GN=Crb1 PE=1 SV=3
8	AFDB:G5EFX6	0.254	0.058	3.318E-2	1410	0.197	0.032	G5EFX6.pdb.gz	SLIT1_CAEEL Slit homolog 1 protein OS=Caenorhabditis elegans OX=6239 GN=slt-1 PE=1 SV=1
9	AFDB:Q9LMP1	0.161	0.065	3.537E-2	732	0.066	0.020	Q9LMP1.pdb.gz	WAK2_ARATH Wall-associated receptor kinase 2 OS=Arabidopsis thaliana OX=3702 GN=WAK2 PE=1 SV=1
10	AFDB:Q90Y57	0.161	0.040	4.566E-2	1242	0.092	0.017	Q90Y57.pdb.gz	JAG1A_DANRE Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1
11	PDB:4rs0A	0.120	0.055	1.602E-1	557	0.052	0.022	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
12	PDB:6y3cA	0.123	0.056	1.602E-1	557	0.057	0.023	6y3cA.pdb.gz
13	PDB:7q3nU	0.119	0.097	3.445E-1	292	0.057	0.045	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
14	PDB:5f1aA	0.119	0.054	3.914E-1	553	0.052	0.022	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
15	PDB:5y31B	0.193	0.096	4.172E-1	511	0.061	0.027	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
16	PDB:3ojyB	0.121	0.059	4.739E-1	504	0.044	0.020	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
17	PDB:7wv3A	0.145	0.056	1.086	668	0.048	0.016	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
18	PDB:7p5vB	0.212	0.072	1.158	732	0.070	0.022	7p5vB.pdb.gz
19	PDB:2pe4A	0.074	0.042	1.593	417	0.039	0.022	2pe4A.pdb.gz
20	PDB:7a5pW	0.192	0.245	1.593	174	0.039	0.052	7a5pW.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UW56	2.88e-171	472	229	1.000	1.000	ARAID_HUMAN All-trans retinoic acid-induced differentiation factor OS=Homo sapiens OX=9606 GN=ATRAID PE=1 SV=2
2	Q6PGD0	8.34e-129	364	223	0.764	0.785	ARAID_MOUSE All-trans retinoic acid-induced differentiation factor OS=Mus musculus OX=10090 GN=Atraid PE=1 SV=2
3	Q9VW71	0.019	38.5	4699	0.092	0.004	FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster OX=7227 GN=kug PE=2 SV=3
4	Q8K1E3	0.14	35.4	382	0.092	0.055	DLK2_MOUSE Protein delta homolog 2 OS=Mus musculus OX=10090 GN=Dlk2 PE=2 SV=3
5	C0LGF5	0.17	35.4	1072	0.131	0.028	RGI5_ARATH LRR receptor-like serine/threonine-protein kinase RGI5 OS=Arabidopsis thaliana OX=3702 GN=RGI5 PE=1 SV=2
6	Q582H5	0.27	34.7	1026	0.131	0.029	Q582H5_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.410 PE=4 SV=1
7	Q6UY11	0.47	33.9	383	0.087	0.052	DLK2_HUMAN Protein delta homolog 2 OS=Homo sapiens OX=9606 GN=DLK2 PE=2 SV=1
8	C0LGJ1	0.55	33.9	1106	0.083	0.017	Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana OX=3702 GN=At1g74360 PE=1 SV=1
9	Q90Y54	0.64	33.5	1213	0.079	0.015	JAG1B_DANRE Protein jagged-1b OS=Danio rerio OX=7955 GN=jag1b PE=2 SV=1
10	C7FZU3	0.70	33.5	1527	0.140	0.021	C7FZU3_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=1
11	Q93791	0.80	33.5	1584	0.140	0.020	Q93791_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=2
12	A0A8I6AQY2	1.3	32.7	4469	0.066	0.003	A0A8I6AQY2_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=1
13	C6GHV6	1.3	32.7	2508	0.066	0.006	C6GHV6_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
14	F1M443	1.3	32.7	4436	0.066	0.003	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
15	F6P8Y7	1.3	32.7	2543	0.066	0.006	F6P8Y7_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
16	Q5GFL6	1.8	32.0	755	0.057	0.017	VWA2_HUMAN von Willebrand factor A domain-containing protein 2 OS=Homo sapiens OX=9606 GN=VWA2 PE=1 SV=1
17	Q9SN80	2.3	32.0	1011	0.148	0.034	Q9SN80_ARATH Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=F1P2.130 PE=1 SV=1
18	Q9JI18	2.4	32.0	4599	0.066	0.003	LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B OS=Mus musculus OX=10090 GN=Lrp1b PE=1 SV=1
19	Q61982	2.7	31.6	2318	0.074	0.007	NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1
20	C0LGU1	2.8	31.6	959	0.052	0.013	Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana OX=3702 GN=At5g37450 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07974 EGF_2	6.2e+02	12.2	EGF-like domain
2	PF12661 hEGF	1.5e+02	14.5	Human growth factor-like EGF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484228

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321498	0.864	Sugar phosphate exchanger 3
2	9606.ENSP00000354553	0.761	Glycosylated lysosomal membrane protein
3	9606.ENSP00000298925	0.728	Protein kinase C-binding protein NELL1
4	9606.ENSP00000394869	0.728	Translation initiation factor eIF-2B subunit delta
5	9606.ENSP00000233575	0.715	Sorting nexin-17
6	9606.ENSP00000343706	0.681	Melanoma-associated antigen H1
7	9606.ENSP00000380638	0.653	Protein-tyrosine kinase 2-beta
8	9606.ENSP00000341189	0.595	Focal adhesion kinase 1
9	9606.ENSP00000193322	0.592	Osteopetrosis-associated transmembrane protein 1
10	9606.ENSP00000365678	0.577	OTU domain-containing protein 1
11	9606.ENSP00000343629	0.576	Protein PRRC2C
12	9606.ENSP00000464743	0.565	Uncharacterized protein FAM215A
13	9606.ENSP00000261600	0.561	THO complex subunit 1
14	9606.ENSP00000371307	0.548	Phospholipid phosphatase 6
15	9606.ENSP00000302564	0.547	Bcl-2-like protein 1
16	9606.ENSP00000310208	0.544	Sodium-dependent multivitamin transporter
17	9606.ENSP00000252998	0.541	RBBP8 N-terminal-like protein
18	9606.ENSP00000281172	0.526	Epidermal growth factor receptor kinase substrate 8
19	9606.ENSP00000323858	0.518	ATP-dependent RNA helicase DDX54
20	9606.ENSP00000260599	0.516	Ketohexokinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.967	regulation of cellular process
GO:0019222	0.964	regulation of metabolic process
GO:0048519	0.960	negative regulation of biological process
GO:0048518	0.939	positive regulation of biological process
GO:0060255	0.939	regulation of macromolecule metabolic process
GO:0048522	0.928	positive regulation of cellular process
GO:0051239	0.900	regulation of multicellular organismal process
GO:0009894	0.890	regulation of catabolic process
GO:0080090	0.879	regulation of primary metabolic process
GO:0051240	0.877	positive regulation of multicellular organismal process
GO:0042127	0.872	regulation of cell population proliferation
GO:0009895	0.872	negative regulation of catabolic process
GO:0030278	0.868	regulation of ossification
GO:0045595	0.866	regulation of cell differentiation
GO:0070167	0.865	regulation of biomineral tissue development
GO:0045667	0.853	regulation of osteoblast differentiation
GO:0051094	0.815	positive regulation of developmental process
GO:0045778	0.795	positive regulation of ossification
GO:0030500	0.788	regulation of bone mineralization
GO:0070169	0.783	positive regulation of biomineral tissue development
GO:0051171	0.763	regulation of nitrogen compound metabolic process
GO:0048523	0.736	negative regulation of cellular process
GO:0051246	0.636	regulation of protein metabolic process
GO:0009987	0.608	cellular process
GO:0030501	0.579	positive regulation of bone mineralization
GO:0045597	0.422	positive regulation of cell differentiation
GO:0010468	0.410	regulation of gene expression
GO:0051172	0.408	negative regulation of nitrogen compound metabolic process
GO:0010605	0.406	negative regulation of macromolecule metabolic process
GO:0042176	0.356	regulation of protein catabolic process
GO:0051248	0.347	negative regulation of protein metabolic process
GO:0045669	0.318	positive regulation of osteoblast differentiation
GO:0042177	0.316	negative regulation of protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.991	endomembrane system
GO:0016020	0.980	membrane
GO:0005634	0.934	nucleus
GO:0031090	0.918	organelle membrane
GO:0031975	0.749	envelope
GO:0031967	0.673	organelle envelope
GO:0048471	0.500	perinuclear region of cytoplasm
GO:0005635	0.498	nuclear envelope
GO:0031981	0.383	nuclear lumen
GO:0098588	0.376	bounding membrane of organelle
GO:0005773	0.346	vacuole
GO:0005764	0.334	lysosome
GO:0005829	0.317	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]