StarFunc result for job id Q6UW78

User Input

>input (93 residues)
MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLL
LATLQEAATTQENVAWRKNWMVGGEGGAGGRSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UW78	1.000	1.000	2.221E-15	93	1.000	1.000	Q6UW78.pdb.gz	UQCC3_HUMAN Ubiquinol-cytochrome-c reductase complex assembly factor 3 OS=Homo sapiens OX=9606 GN=UQCC3 PE=1 SV=2
2	AFDB:P9WLK3	0.291	0.107	3.809	314	0.237	0.070	P9WLK3.pdb.gz	Y2083_MYCTU Uncharacterized protein Rv2083 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2083 PE=4 SV=1
3	AFDB:O96291	0.285	0.107	4.863	304	0.183	0.056	O96291.pdb.gz	O96291_PLAF7 Stevor OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0222800 PE=4 SV=3
4	AFDB:O17209	0.324	0.122	5.723	298	0.108	0.034	O17209.pdb.gz	O17209_CAEEL Nematode cuticle collagen N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sqt-2 PE=1 SV=1
5	AFDB:O17724	0.249	0.108	5.723	252	0.065	0.024	O17724.pdb.gz	O17724_CAEEL High Incidence of Males (Increased X chromosome loss) OS=Caenorhabditis elegans OX=6239 GN=him-5 PE=4 SV=1
6	AFDB:Q86W67	0.303	0.140	6.208	206	0.172	0.078	Q86W67.pdb.gz	F228A_HUMAN Protein FAM228A OS=Homo sapiens OX=9606 GN=FAM228A PE=1 SV=1
7	AFDB:E9PRI3	0.300	0.284	6.734	99	0.118	0.111	E9PRI3.pdb.gz	E9PRI3_HUMAN WEE1 G2 checkpoint kinase (Fragment) OS=Homo sapiens OX=9606 GN=WEE1 PE=1 SV=1
8	AFDB:Q8N128	0.222	0.119	7.305	213	0.226	0.099	Q8N128.pdb.gz	F177A_HUMAN Protein FAM177A1 OS=Homo sapiens OX=9606 GN=FAM177A1 PE=1 SV=1
9	AFDB:H2L0C3	0.298	0.096	7.925	458	0.129	0.026	H2L0C3.pdb.gz	H2L0C3_CAEEL Dystroglycan-type cadherin-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sgca-1 PE=1 SV=1
10	AFDB:E9Q6B2	0.284	0.073	8.597	420	0.226	0.050	E9Q6B2.pdb.gz	CC85C_MOUSE Coiled-coil domain-containing protein 85C OS=Mus musculus OX=10090 GN=Ccdc85c PE=1 SV=1
11	PDB:6uiwA	0.270	0.118	8.679	294	0.097	0.031	6uiwA.pdb.gz	The structures and gating mechanism of human calcium homeostasis modulator 2.
12	PDB:6f44W	0.175	0.108	9.415	172	0.129	0.070	6f44W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UW78	3.39e-62	185	93	1.000	1.000	UQCC3_HUMAN Ubiquinol-cytochrome-c reductase complex assembly factor 3 OS=Homo sapiens OX=9606 GN=UQCC3 PE=1 SV=2
2	P11079	0.22	32.0	1289	0.140	0.010	LMBD2_REOVD Outer capsid protein lambda-2 OS=Reovirus type 3 (strain Dearing) OX=10886 GN=L2 PE=1 SV=2
3	Q0KK55	0.71	30.4	1742	0.194	0.010	KNDC1_MOUSE Kinase non-catalytic C-lobe domain-containing protein 1 OS=Mus musculus OX=10090 GN=Kndc1 PE=1 SV=2
4	Q95XG8	1.4	29.6	560	0.129	0.021	NRAMC_CAEEL NRAMP-like transporter smf-3 OS=Caenorhabditis elegans OX=6239 GN=smf-3 PE=1 SV=3
5	P34425	1.8	29.3	468	0.161	0.032	CCNT1_CAEEL Cyclin-T1.1 OS=Caenorhabditis elegans OX=6239 GN=cit-1.1 PE=3 SV=1
6	A0A1D8PK53	3.0	28.9	4161	0.247	0.006	A0A1D8PK53_CANAL Dynein heavy chain, cytoplasmic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DYN1 PE=4 SV=1
7	P37107	3.1	28.5	564	0.237	0.039	SR54C_ARATH Signal recognition particle subunit SRP54, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FFC PE=1 SV=1
8	Q8J2Q9	3.5	28.5	306	0.172	0.052	FUM11_GIBM7 Tricarboxylate transporter FUM11 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) OX=334819 GN=FUM11 PE=3 SV=2
9	Q0E8J4	4.1	28.5	3079	0.129	0.004	Q0E8J4_DROME Zormin, isoform G OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
10	M9PBJ1	4.4	28.1	3664	0.129	0.003	M9PBJ1_DROME Zormin, isoform J OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
11	M9PE03	4.5	28.1	3536	0.129	0.003	M9PE03_DROME Zormin, isoform E OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
12	Q0E8J3	4.5	28.1	3640	0.129	0.003	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
13	Q0E8J5	4.5	28.1	2960	0.129	0.004	Q0E8J5_DROME Zormin, isoform K OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
14	Q7Z1Y4	4.5	28.1	2935	0.129	0.004	Q7Z1Y4_DROME Zormin OS=Drosophila melanogaster OX=7227 GN=zormin PE=4 SV=1
15	Q9W053	4.5	28.1	2935	0.129	0.004	Q9W053_DROME Zormin, isoform F OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=4
16	Q38DT4	7.1	27.3	335	0.204	0.057	Q38DT4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2220 PE=4 SV=1
17	Q9FK37	7.2	27.7	584	0.140	0.022	Q9FK37_ARATH Uncharacterized protein At5g50350 OS=Arabidopsis thaliana OX=3702 GN=MXI22.6 PE=1 SV=1
18	H0YDN1	7.8	27.7	3447	0.140	0.004	H0YDN1_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=9
19	Q7PC87	8.9	27.3	1453	0.172	0.011	AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana OX=3702 GN=ABCG34 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15141 UQCC3	9.5e-39	142.5	Ubiquinol-cytochrome-c reductase complex assembly factor 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000432692

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367878	0.714	UPF0705 protein C11orf49
2	9606.ENSP00000476140	0.697	Ubiquinol-cytochrome-c reductase complex assembly factor 2
3	9606.ENSP00000261647	0.685	Tetratricopeptide repeat protein 19, mitochondrial
4	9606.ENSP00000363506	0.662	Ubiquinol-cytochrome-c reductase complex assembly factor 1
5	9606.ENSP00000368688	0.654	Complex III assembly factor LYRM7
6	9606.ENSP00000403910	0.636	Distal membrane-arm assembly complex protein 2
7	9606.ENSP00000301790	0.593	Ca(2+)-independent N-acyltransferase
8	9606.ENSP00000413908	0.585	Mitochondrial chaperone BCS1
9	9606.ENSP00000360270	0.553	Metalloendopeptidase OMA1, mitochondrial
10	9606.ENSP00000361923	0.547	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
11	9606.ENSP00000360782	0.541	Mitochondrial-processing peptidase subunit alpha
12	9606.ENSP00000367938	0.527	Cytochrome c oxidase subunit 7A-related protein, mitochondrial
13	9606.ENSP00000367939	0.507	Cytochrome b-c1 complex subunit 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070300	1.000	phosphatidic acid binding
GO:1901612	1.000	cardiolipin binding
GO:0005515	0.772	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0033108	0.991	mitochondrial respiratory chain complex assembly
GO:0008152	0.989	metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0017004	0.957	cytochrome complex assembly
GO:0045333	0.955	cellular respiration
GO:0006119	0.895	oxidative phosphorylation
GO:0022904	0.827	respiratory electron transport chain
GO:0019646	0.803	aerobic electron transport chain
GO:0042775	0.803	mitochondrial ATP synthesis coupled electron transport
GO:0061024	0.776	membrane organization
GO:0007007	0.753	inner mitochondrial membrane organization
GO:0034551	0.468	mitochondrial respiratory chain complex III assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990204	0.999	oxidoreductase complex
GO:0005829	0.999	cytosol
GO:0098803	0.999	respiratory chain complex
GO:0005654	0.999	nucleoplasm
GO:0098800	0.999	inner mitochondrial membrane protein complex
GO:0005746	0.998	mitochondrial respirasome
GO:1902495	0.997	transmembrane transporter complex
GO:0070069	0.995	cytochrome complex
GO:0005750	0.988	mitochondrial respiratory chain complex III

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]