StarFunc result for job id Q6UW88

User Input

>input (154 residues)
MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLC
LEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGL
LLSGFLVIFYCYIRKRCLKLKSPYNVCSGERRPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UW88	1.000	1.000	2.542E-28	154	1.000	1.000	Q6UW88.pdb.gz	EPGN_HUMAN Epigen OS=Homo sapiens OX=9606 GN=EPGN PE=1 SV=2
2	AFDB:Q924X1	0.655	0.663	2.020E-21	152	0.773	0.783	Q924X1.pdb.gz	EPGN_MOUSE Epigen OS=Mus musculus OX=10090 GN=Epgn PE=2 SV=1
3	AFDB:P01135	0.344	0.334	7.250E-8	160	0.201	0.194	P01135.pdb.gz	TGFA_HUMAN Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1
4	AFDB:Q05928	0.485	0.436	8.350E-8	177	0.234	0.203	Q05928.pdb.gz	BTC_MOUSE Probetacellulin OS=Mus musculus OX=10090 GN=Btc PE=1 SV=1
5	AFDB:Q8IYR6	0.384	0.179	1.369E-7	380	0.201	0.082	Q8IYR6.pdb.gz	TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens OX=9606 GN=TMEFF1 PE=1 SV=1
6	AFDB:Q64EU6	0.391	0.359	1.576E-7	171	0.227	0.205	Q64EU6.pdb.gz	Q64EU6_CHICK Betacellulin OS=Gallus gallus OX=9031 GN=BTC PE=2 SV=1
7	AFDB:P35070	0.482	0.432	3.679E-7	178	0.214	0.185	P35070.pdb.gz	BTC_HUMAN Probetacellulin OS=Homo sapiens OX=9606 GN=BTC PE=1 SV=1
8	AFDB:Q6J1M9	0.451	0.446	4.879E-7	156	0.214	0.212	Q6J1M9.pdb.gz	Q6J1M9_CHICK Transforming growth factor alpha OS=Gallus gallus OX=9031 PE=2 SV=1
9	AFDB:Q61521	0.349	0.335	1.222E-6	162	0.247	0.235	Q61521.pdb.gz	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1
10	AFDB:O14944	0.410	0.381	2.150E-6	169	0.266	0.243	O14944.pdb.gz	EREG_HUMAN Proepiregulin OS=Homo sapiens OX=9606 GN=EREG PE=1 SV=1
11	PDB:5es4B	0.170	0.044	3.001E-1	674	0.097	0.022	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
12	PDB:3t5oA	0.200	0.038	3.220E-1	871	0.065	0.011	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
13	PDB:7nycD	0.186	0.061	3.980E-1	487	0.065	0.021	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	PDB:7nycC	0.209	0.043	5.665E-1	809	0.065	0.012	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
15	PDB:6y3cA	0.203	0.061	6.525E-1	557	0.084	0.023	6y3cA.pdb.gz
16	PDB:5f1aA	0.208	0.062	8.654E-1	553	0.065	0.018	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
17	PDB:7q3nU	0.166	0.094	1.070	292	0.065	0.034	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
18	PDB:4rs0A	0.207	0.061	1.419	557	0.065	0.018	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
19	PDB:6h03C	0.204	0.066	1.523	513	0.065	0.019	6h03C.pdb.gz
20	PDB:2hoxD	0.168	0.068	1.634	427	0.058	0.021	2hoxD.pdb.gz	Two Structures of Alliinase from Alliium sativum L.: Apo Form and Ternary Complex with Aminoacrylate Reaction Intermediate Covalently Bound to the PLP Cofactor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UW88	1.68e-113	320	154	1.000	1.000	EPGN_HUMAN Epigen OS=Homo sapiens OX=9606 GN=EPGN PE=1 SV=2
2	Q924X1	7.26e-84	244	152	0.779	0.789	EPGN_MOUSE Epigen OS=Mus musculus OX=10090 GN=Epgn PE=2 SV=1
3	P01135	5.37e-09	53.9	160	0.201	0.194	TGFA_HUMAN Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1
4	P01134	6.11e-09	53.9	159	0.201	0.195	TGFA_RAT Protransforming growth factor alpha OS=Rattus norvegicus OX=10116 GN=Tgfa PE=1 SV=2
5	P48030	1.01e-08	53.1	159	0.201	0.195	TGFA_MOUSE Protransforming growth factor alpha OS=Mus musculus OX=10090 GN=Tgfa PE=1 SV=1
6	Q61521	3.43e-08	52.0	162	0.214	0.204	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1
7	O14944	5.43e-08	51.6	169	0.175	0.160	EREG_HUMAN Proepiregulin OS=Homo sapiens OX=9606 GN=EREG PE=1 SV=1
8	A0A0R4IPH3	5.48e-08	53.1	722	0.221	0.047	A0A0R4IPH3_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
9	Q8IYR6	7.36e-08	52.4	380	0.195	0.079	TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens OX=9606 GN=TMEFF1 PE=1 SV=1
10	Q9Z0L5	2.48e-07	49.7	162	0.169	0.160	EREG_RAT Proepiregulin OS=Rattus norvegicus OX=10116 GN=Ereg PE=1 SV=1
11	P56974	2.83e-07	50.8	756	0.188	0.038	NRG2_MOUSE Pro-neuregulin-2, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg2 PE=1 SV=1
12	A0A0R4IBM0	7.26e-07	49.7	730	0.221	0.047	A0A0R4IBM0_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
13	A0A1B4Z255	1.02e-06	49.3	604	0.221	0.056	A0A1B4Z255_DANRE Neuregulin1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=2 SV=1
14	A9JRW9	2.99e-06	47.4	230	0.188	0.126	A9JRW9_DANRE Heparin-binding EGF-like growth factor a OS=Danio rerio OX=7955 GN=hbegfa PE=2 SV=1
15	Q6VQA2	3.28e-06	47.8	1114	0.175	0.024	Q6VQA2_DANRE Pro-epidermal growth factor OS=Danio rerio OX=7955 GN=egf PE=2 SV=1
16	Q6J1M9	3.72e-06	46.2	156	0.260	0.256	Q6J1M9_CHICK Transforming growth factor alpha OS=Gallus gallus OX=9031 PE=2 SV=1
17	Q9W7C5	3.82e-06	47.0	212	0.247	0.179	HBEGF_CHICK Proheparin-binding EGF-like growth factor OS=Gallus gallus OX=9031 GN=HBEGF PE=1 SV=1
18	A0A0R4IFE6	8.78e-06	46.6	687	0.312	0.070	A0A0R4IFE6_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
19	Q6DR98	9.75e-06	46.6	645	0.260	0.062	NRG1_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
20	O14511	1.42e-05	45.8	850	0.201	0.036	NRG2_HUMAN Pro-neuregulin-2, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14986 DUF4514	59	15.1	Domain of unknown function (DUF4514)
2	PF00008 EGF	4.2	19.1	EGF-like domain
3	PF07974 EGF_2	1.8e+02	13.9	EGF-like domain
4	PF00053 Laminin_EGF	8.1e+02	11.6	Laminin EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411898

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
2	9606.ENSP00000256078	0.919	GTPase KRas
3	9606.ENSP00000379092	0.919	Probetacellulin
4	9606.ENSP00000407586	0.918	GTPase HRas
5	9606.ENSP00000273261	0.916	Leucine-rich repeats and immunoglobulin-like domains protein 1
6	9606.ENSP00000306245	0.908	Proto-oncogene c-Fos
7	9606.ENSP00000220003	0.902	Tyrosine-protein kinase CSK
8	9606.ENSP00000220597	0.900	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
9	9606.ENSP00000267257	0.900	Paxillin
10	9606.ENSP00000357196	0.900	Receptor-type tyrosine-protein phosphatase kappa
11	9606.ENSP00000358548	0.900	GTPase NRas
12	9606.ENSP00000363667	0.900	Tyrosine-protein phosphatase non-receptor type 3
13	9606.ENSP00000379097	0.896	Amphiregulin
14	9606.ENSP00000230990	0.879	Proheparin-binding EGF-like growth factor
15	9606.ENSP00000265171	0.823	Pro-epidermal growth factor
16	9606.ENSP00000264033	0.721	E3 ubiquitin-protein ligase CBL
17	9606.ENSP00000342235	0.665	Receptor tyrosine-protein kinase erbB-4
18	9606.ENSP00000401303	0.663	SHC-transforming protein 1
19	9606.ENSP00000267101	0.662	Receptor tyrosine-protein kinase erbB-3
20	9606.ENSP00000378367	0.646	Pro-neuregulin-4, membrane-bound isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005154	0.999	epidermal growth factor receptor binding
GO:0008083	0.999	growth factor activity
GO:0030297	0.301	transmembrane receptor protein tyrosine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048522	0.993	positive regulation of cellular process
GO:0044093	0.981	positive regulation of molecular function
GO:0051130	0.977	positive regulation of cellular component organization
GO:0050790	0.976	regulation of catalytic activity
GO:0050731	0.976	positive regulation of peptidyl-tyrosine phosphorylation
GO:1902531	0.975	regulation of intracellular signal transduction
GO:0042127	0.974	regulation of cell population proliferation
GO:0045860	0.974	positive regulation of protein kinase activity
GO:1902533	0.972	positive regulation of intracellular signal transduction
GO:1901184	0.971	regulation of ERBB signaling pathway
GO:0032501	0.970	multicellular organismal process
GO:0045840	0.967	positive regulation of mitotic nuclear division
GO:0009987	0.964	cellular process
GO:0043410	0.963	positive regulation of MAPK cascade
GO:2000273	0.958	positive regulation of signaling receptor activity
GO:0045742	0.958	positive regulation of epidermal growth factor receptor signaling pathway
GO:0061098	0.957	positive regulation of protein tyrosine kinase activity
GO:0043405	0.933	regulation of MAP kinase activity
GO:0071902	0.932	positive regulation of protein serine/threonine kinase activity
GO:0008284	0.922	positive regulation of cell population proliferation
GO:0032502	0.914	developmental process
GO:0050896	0.912	response to stimulus
GO:0043406	0.911	positive regulation of MAP kinase activity
GO:0048856	0.903	anatomical structure development
GO:0007165	0.869	signal transduction
GO:0007275	0.854	multicellular organism development
GO:0048731	0.801	system development
GO:0007166	0.694	cell surface receptor signaling pathway
GO:0009653	0.662	anatomical structure morphogenesis
GO:0007169	0.565	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0038127	0.547	ERBB signaling pathway
GO:0007173	0.424	epidermal growth factor receptor signaling pathway
GO:0072359	0.343	circulatory system development
GO:0048519	0.316	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005886	0.984	plasma membrane
GO:0043226	0.976	organelle
GO:0005737	0.975	cytoplasm
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0031090	0.935	organelle membrane
GO:0031982	0.927	vesicle
GO:0030659	0.924	cytoplasmic vesicle membrane
GO:0030139	0.922	endocytic vesicle
GO:0098588	0.915	bounding membrane of organelle
GO:0030666	0.904	endocytic vesicle membrane
GO:0030669	0.877	clathrin-coated endocytic vesicle membrane
GO:0005615	0.832	extracellular space
GO:0005829	0.398	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]