StarFunc result for job id Q6UWB1

User Input

>input (636 residues)
MRGGRGAPFWLWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDL
GAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFV
NLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLE
PELKTIPLTPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSG
NLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGITCCCSLIPSGAEWARVSA
VNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGPGEPLEHVVDWARDGD
PLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREELAPLVGP
TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDL
PWGPCELWVTASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLLGCGLSLATSG
RCYHLRHKVLPRWVWEKVPDPANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESS
QPAQATAPLDSGYEKHFLPTPEELGLLGPPRPQVLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UWB1	1.000	1.000	0.000	636	1.000	1.000	Q6UWB1.pdb.gz	I27RA_HUMAN Interleukin-27 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL27RA PE=1 SV=2
2	AFDB:O70394	0.642	0.653	2.831E-71	623	0.612	0.624	O70394.pdb.gz	I27RA_MOUSE Interleukin-27 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il27ra PE=1 SV=2
3	AFDB:Q99665	0.573	0.442	4.772E-29	862	0.228	0.168	Q99665.pdb.gz	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
4	AFDB:P40189	0.537	0.395	1.646E-28	918	0.190	0.132	P40189.pdb.gz	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
5	AFDB:Q8K5B1	0.533	0.486	3.205E-28	716	0.190	0.169	Q8K5B1.pdb.gz	IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il31ra PE=1 SV=3
6	AFDB:Q00560	0.513	0.380	7.201E-28	917	0.189	0.131	Q00560.pdb.gz	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
7	AFDB:P97378	0.545	0.416	7.553E-28	874	0.217	0.158	P97378.pdb.gz	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
8	AFDB:P40190	0.513	0.379	1.159E-27	918	0.186	0.129	P40190.pdb.gz	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
9	AFDB:A8WH79	0.537	0.415	1.275E-27	866	0.197	0.144	A8WH79.pdb.gz	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
10	AFDB:F1LRH7	0.517	0.399	2.605E-27	869	0.203	0.148	F1LRH7.pdb.gz	F1LRH7_RAT Interleukin 12 receptor subunit beta 2 OS=Rattus norvegicus OX=10116 GN=Il12rb2 PE=3 SV=2
11	PDB:6pxvA	0.183	0.153	1.041E-10	823	0.086	0.067	6pxvA.pdb.gz
12	PDB:8dtlA	0.166	0.149	4.553E-10	741	0.079	0.067	8dtlA.pdb.gz
13	PDB:4rtdA	0.109	0.073	1.811E-9	1122	0.118	0.067	4rtdA.pdb.gz
14	PDB:8eyyA	0.172	0.150	5.957E-9	775	0.083	0.068	8eyyA.pdb.gz
15	PDB:6pyhD	0.183	0.157	7.558E-9	798	0.088	0.070	6pyhD.pdb.gz
16	PDB:7q1yA	0.135	0.073	7.793E-8	1374	0.090	0.041	7q1yA.pdb.gz
17	PDB:7q5zA	0.116	0.068	7.793E-8	1344	0.085	0.040	7q5zA.pdb.gz
18	PDB:4lnvB	0.111	0.077	8.989E-8	1063	0.104	0.062	4lnvB.pdb.gz
19	PDB:5oj2B	0.131	0.123	1.196E-7	692	0.119	0.110	5oj2B.pdb.gz
20	PDB:4ziqA	0.115	0.063	1.255E-7	1450	0.127	0.056	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70394	0.0	737	623	0.602	0.615	I27RA_MOUSE Interleukin-27 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il27ra PE=1 SV=2
2	Q6UWB1	0.0	1266	636	1.000	1.000	I27RA_HUMAN Interleukin-27 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL27RA PE=1 SV=2
3	Q99665	8.70e-27	118	862	0.203	0.150	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
4	P97378	1.46e-21	102	874	0.171	0.125	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
5	F1LRH7	6.82e-21	100	869	0.171	0.125	F1LRH7_RAT Interleukin 12 receptor subunit beta 2 OS=Rattus norvegicus OX=10116 GN=Il12rb2 PE=3 SV=2
6	P40189	9.43e-16	83.6	918	0.165	0.114	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
7	Q17RA0	1.28e-15	83.2	918	0.165	0.114	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
8	F1RCZ2	1.78e-15	82.8	859	0.211	0.156	F1RCZ2_DANRE Interleukin 6 cytokine family signal transduce OS=Danio rerio OX=7955 GN=gp130 PE=4 SV=2
9	Q00560	6.63e-13	74.3	917	0.153	0.106	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
10	A0A0A0MTN7	7.17e-12	70.5	549	0.118	0.137	A0A0A0MTN7_HUMAN Interleukin 12 receptor subunit beta 2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=2
11	O70458	7.77e-12	70.9	971	0.239	0.157	OSMR_MOUSE Oncostatin-M-specific receptor subunit beta OS=Mus musculus OX=10090 GN=Osmr PE=1 SV=1
12	A8WH79	1.26e-10	67.0	866	0.203	0.149	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
13	P40190	8.71e-10	64.3	918	0.153	0.106	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
14	Q99650	9.88e-10	64.3	979	0.175	0.113	OSMR_HUMAN Oncostatin-M-specific receptor subunit beta OS=Homo sapiens OX=9606 GN=OSMR PE=1 SV=1
15	O70535	1.09e-09	64.3	1093	0.116	0.068	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
16	P40223	1.74e-09	63.5	837	0.233	0.177	CSF3R_MOUSE Granulocyte colony-stimulating factor receptor OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2
17	P42703	1.07e-08	60.8	1092	0.104	0.060	LIFR_MOUSE Leukemia inhibitory factor receptor OS=Mus musculus OX=10090 GN=Lifr PE=1 SV=1
18	Q92823	8.47e-08	58.2	1304	0.119	0.058	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
19	D4A3R0	2.94e-07	56.2	849	0.204	0.153	D4A3R0_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=2
20	P42702	3.83e-07	55.8	1097	0.052	0.030	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	9.4e-10	50.0	Fibronectin type III domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349365	0.995	Interleukin-27 subunit alpha
2	9606.ENSP00000221847	0.979	Interleukin-27 subunit beta
3	9606.ENSP00000354394	0.978	Signal transducer and activator of transcription 1-alpha/beta
4	9606.ENSP00000264657	0.973	Signal transducer and activator of transcription 3
5	9606.ENSP00000343204	0.969	Tyrosine-protein kinase JAK1
6	9606.ENSP00000368265	0.953	Ciliary neurotrophic factor receptor subunit alpha
7	9606.ENSP00000376134	0.940	Signal transducer and activator of transcription 4
8	9606.ENSP00000431885	0.936	Non-receptor tyrosine-protein kinase TYK2
9	9606.ENSP00000341208	0.935	Signal transducer and activator of transcription 5A
10	9606.ENSP00000370698	0.932	Interleukin-6 receptor subunit beta
11	9606.ENSP00000371067	0.932	Tyrosine-protein kinase JAK2
12	9606.ENSP00000315768	0.917	Signal transducer and activator of transcription 2
13	9606.ENSP00000355370	0.872	Ciliary neurotrophic factor
14	9606.ENSP00000262345	0.856	Interleukin-12 receptor subunit beta-2
15	9606.ENSP00000385675	0.856	Interleukin-6
16	9606.ENSP00000302924	0.822	Interleukin-17D
17	9606.ENSP00000470788	0.807	Interleukin-12 receptor subunit beta-1
18	9606.ENSP00000412237	0.803	Interleukin-10
19	9606.ENSP00000303231	0.776	Interleukin-12 subunit alpha
20	9606.ENSP00000264563	0.774	Interleukin-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0005102	0.313	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050896	0.996	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0023052	0.990	signaling
GO:0009987	0.990	cellular process
GO:0048519	0.985	negative regulation of biological process
GO:0007154	0.979	cell communication
GO:0007165	0.969	signal transduction
GO:0048523	0.965	negative regulation of cellular process
GO:0010941	0.943	regulation of cell death
GO:0002376	0.931	immune system process
GO:0007166	0.913	cell surface receptor signaling pathway
GO:0042981	0.882	regulation of apoptotic process
GO:0048518	0.868	positive regulation of biological process
GO:0019222	0.861	regulation of metabolic process
GO:0060255	0.849	regulation of macromolecule metabolic process
GO:0009893	0.811	positive regulation of metabolic process
GO:0010604	0.803	positive regulation of macromolecule metabolic process
GO:0010468	0.792	regulation of gene expression
GO:0048583	0.782	regulation of response to stimulus
GO:0006955	0.761	immune response
GO:0051239	0.752	regulation of multicellular organismal process
GO:0048522	0.736	positive regulation of cellular process
GO:0060548	0.647	negative regulation of cell death
GO:0043066	0.637	negative regulation of apoptotic process
GO:0051240	0.559	positive regulation of multicellular organismal process
GO:0048584	0.536	positive regulation of response to stimulus
GO:0002682	0.534	regulation of immune system process
GO:0001817	0.518	regulation of cytokine production
GO:0031323	0.512	regulation of cellular metabolic process
GO:1901214	0.508	regulation of neuron death
GO:0080090	0.503	regulation of primary metabolic process
GO:0051171	0.503	regulation of nitrogen compound metabolic process
GO:0006950	0.501	response to stress
GO:0010628	0.494	positive regulation of gene expression
GO:0042221	0.486	response to chemical
GO:0001819	0.477	positive regulation of cytokine production
GO:0050865	0.469	regulation of cell activation
GO:0002694	0.417	regulation of leukocyte activation
GO:0051249	0.413	regulation of lymphocyte activation
GO:0002684	0.401	positive regulation of immune system process
GO:0042127	0.393	regulation of cell population proliferation
GO:0044419	0.369	biological process involved in interspecies interaction between organisms
GO:0009607	0.368	response to biotic stimulus
GO:0009605	0.361	response to external stimulus
GO:0070887	0.344	cellular response to chemical stimulus
GO:0006952	0.331	defense response
GO:0050776	0.319	regulation of immune response
GO:1901215	0.315	negative regulation of neuron death
GO:0043523	0.313	regulation of neuron apoptotic process
GO:0071345	0.308	cellular response to cytokine stimulus
GO:0051707	0.305	response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.914	extracellular region
GO:0005622	0.874	intracellular anatomical structure
GO:0005737	0.750	cytoplasm
GO:0043229	0.675	intracellular organelle
GO:0043231	0.667	intracellular membrane-bounded organelle
GO:0012505	0.446	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]