StarFunc result for job id Q6UWI2

User Input

>input (310 residues)
MVYKTLFALCILTAGWRVQSLPTSAPLSVSLPTNIVPPTTIWTSSPQNTDADTASPSNGT
HNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTT
TLEEHSSGTPEAGVAATLSQSAAEPPTLISPQAPASSPSSLSTSPPEVFSASVTTNHSST
VTSTQPTGAPTAPESPTEESSSDHTPTSHATAEPVPQEKTPPTTVSGKVMCELIDMETTT
TFPRVIMQEVEHALSSGSIAAITVTVIAVVLLVFGVAAYLKIRHSSYGRLLDDHDYGSWG
NYNNPLYDDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UWI2	0.999	0.999	8.028E-43	310	1.000	1.000	Q6UWI2.pdb.gz	PARM1_HUMAN Prostate androgen-regulated mucin-like protein 1 OS=Homo sapiens OX=9606 GN=PARM1 PE=1 SV=1
2	AFDB:Q9I920	0.085	0.031	2.808	1183	0.132	0.035	Q9I920.pdb.gz	BLM_CHICK RecQ-like DNA helicase BLM OS=Gallus gallus OX=9031 GN=BLM PE=1 SV=2
3	AFDB:Q9Y5I2	0.084	0.032	4.654	948	0.123	0.040	Q9Y5I2.pdb.gz	PCDAA_HUMAN Protocadherin alpha-10 OS=Homo sapiens OX=9606 GN=PCDHA10 PE=2 SV=1
4	AFDB:Q9UKB5	0.135	0.108	5.377	411	0.161	0.122	Q9UKB5.pdb.gz	AJAP1_HUMAN Adherens junction-associated protein 1 OS=Homo sapiens OX=9606 GN=AJAP1 PE=1 SV=1
5	AFDB:P19814	0.079	0.072	5.780	357	0.213	0.185	P19814.pdb.gz	TGON3_RAT Trans-Golgi network integral membrane protein TGN38 OS=Rattus norvegicus OX=10116 GN=Ttgn1 PE=1 SV=1
6	AFDB:Q9XUS2	0.079	0.060	5.780	441	0.177	0.125	Q9XUS2.pdb.gz	MED29_CAEEL Mediator of RNA polymerase II transcription subunit 29 OS=Caenorhabditis elegans OX=6239 GN=mdt-29 PE=1 SV=1
7	AFDB:Q21610	0.090	0.053	6.212	627	0.132	0.065	Q21610.pdb.gz	Q21610_CAEEL Par-2 protein OS=Caenorhabditis elegans OX=6239 GN=par-2 PE=2 SV=1
8	AFDB:Q17423	0.072	0.026	7.715	1282	0.132	0.032	Q17423.pdb.gz	CREC_CAEEL Crescerin-like protein che-12 OS=Caenorhabditis elegans OX=6239 GN=che-12 PE=1 SV=3
9	AFDB:Q7KU24	0.110	0.026	7.715	1883	0.155	0.025	Q7KU24.pdb.gz	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1
10	AFDB:Q8LPG9	0.103	0.053	7.715	668	0.161	0.075	Q8LPG9.pdb.gz	IQD14_ARATH Protein IQ-DOMAIN 14 OS=Arabidopsis thaliana OX=3702 GN=IQD14 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UWI2	0.0	612	310	1.000	1.000	PARM1_HUMAN Prostate androgen-regulated mucin-like protein 1 OS=Homo sapiens OX=9606 GN=PARM1 PE=1 SV=1
2	Q6P9X9	6.19e-113	330	296	0.632	0.662	PARM1_RAT Prostate androgen-regulated mucin-like protein 1 homolog OS=Rattus norvegicus OX=10116 GN=Parm1 PE=1 SV=1
3	Q9VB11	0.077	37.4	3303	0.142	0.013	UNC80_DROME Protein unc-80 homolog OS=Drosophila melanogaster OX=7227 GN=unc80 PE=1 SV=5
4	A0A8I6AP19	0.29	35.4	1297	0.116	0.028	A0A8I6AP19_RAT Splicing factor 3b, subunit 1 OS=Rattus norvegicus OX=10116 GN=Sf3b1 PE=1 SV=1
5	G3V7T6	0.31	35.4	1304	0.116	0.028	G3V7T6_RAT Splicing factor 3b, subunit 1 OS=Rattus norvegicus OX=10116 GN=Sf3b1 PE=1 SV=1
6	O75533	0.31	35.4	1304	0.116	0.028	SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3
7	Q99NB9	0.31	35.4	1304	0.116	0.028	SF3B1_MOUSE Splicing factor 3B subunit 1 OS=Mus musculus OX=10090 GN=Sf3b1 PE=1 SV=1
8	A4GSN8	2.5	32.3	2093	0.110	0.016	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
9	C7DZK3	2.8	32.3	1783	0.100	0.017	CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio OX=7955 GN=col27a1a PE=2 SV=1
10	Q8IZC6	3.9	32.0	1860	0.145	0.024	CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens OX=9606 GN=COL27A1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17061 PARM	7.7e-144	490.9	PARM
2	PF03302 VSP	84	13.5	Giardia variant-specific surface protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370224

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281924	0.636	Transmembrane protein 163
2	9606.ENSP00000268720	0.630	Copine-7
3	9606.ENSP00000388241	0.620	Kinesin-like protein KIF26A
4	9606.ENSP00000258302	0.617	Regulator of G-protein signaling 8
5	9606.ENSP00000248248	0.562	MON1 homolog B, secretory trafficking associated
6	9606.ENSP00000361311	0.543	Transmembrane protein 53
7	9606.ENSP00000252506	0.536	Growth arrest and DNA damage-inducible protein GADD45 gamma
8	9606.ENSP00000360552	0.518	Teashirt homolog 2
9	9606.ENSP00000310435	0.502	Beta/gamma crystallin domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.987	positive regulation of biological process
GO:0050790	0.986	regulation of catalytic activity
GO:0051052	0.982	regulation of DNA metabolic process
GO:0044093	0.978	positive regulation of molecular function
GO:0048522	0.978	positive regulation of cellular process
GO:0009893	0.975	positive regulation of metabolic process
GO:0051338	0.971	regulation of transferase activity
GO:0010556	0.957	regulation of macromolecule biosynthetic process
GO:0051173	0.957	positive regulation of nitrogen compound metabolic process
GO:0031326	0.957	regulation of cellular biosynthetic process
GO:0010604	0.956	positive regulation of macromolecule metabolic process
GO:2000278	0.942	regulation of DNA biosynthetic process
GO:0043085	0.940	positive regulation of catalytic activity
GO:0051054	0.923	positive regulation of DNA metabolic process
GO:0010557	0.921	positive regulation of macromolecule biosynthetic process
GO:0031328	0.921	positive regulation of cellular biosynthetic process
GO:0051972	0.893	regulation of telomerase activity
GO:2000573	0.893	positive regulation of DNA biosynthetic process
GO:0009987	0.729	cellular process
GO:0051347	0.665	positive regulation of transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0005768	0.995	endosome
GO:0005770	0.986	late endosome
GO:0005769	0.984	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]