StarFunc result for job id Q6UWI4

User Input

>input (295 residues)
MWGARRSSVSSSWNAASLLQLLLAALLAAGARASGEYCHGWLDAQGVWRIGFQCPERFDG
GDATICCGSCALRYCCSSAEARLDQGGCDNDRQQGAGEPGRADKDGPDGSAVPIYVPFLI
VGSVFVAFIILGSLVAACCCRCLRPKQDPQQSRAPGGNRLMETIPMIPSASTSRGSSSRQ
SSTAASSSSSANSGARAPPTRSQTNCCLPEGTMNNVYVNMPTNFSVLNCQQATQIVPHQG
QYLHPPYVGYTVQHDSVPMTAVPPFMDGLQPGYRQIQSPFPHTNSEQKMYPAVTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UWI4	0.999	0.999	4.606E-49	295	1.000	1.000	Q6UWI4.pdb.gz	SHSA2_HUMAN Protein shisa-2 homolog OS=Homo sapiens OX=9606 GN=SHISA2 PE=1 SV=1
2	AFDB:A0PJX4	0.330	0.391	6.436E-20	238	0.400	0.496	A0PJX4.pdb.gz	SHSA3_HUMAN Protein shisa-3 homolog OS=Homo sapiens OX=9606 GN=SHISA3 PE=1 SV=1
3	AFDB:Q3UH99	0.245	0.144	1.245E-9	525	0.210	0.118	Q3UH99.pdb.gz	SHSA6_MOUSE Protein shisa-6 OS=Mus musculus OX=10090 GN=Shisa6 PE=1 SV=1
4	AFDB:Q9CZN4	0.191	0.136	8.430E-8	424	0.169	0.118	Q9CZN4.pdb.gz	SHSA9_MOUSE Protein shisa-9 OS=Mus musculus OX=10090 GN=Shisa9 PE=1 SV=2
5	AFDB:F1QRP2	0.114	0.038	2.546E-1	1135	0.139	0.036	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
6	AFDB:Q810B8	0.111	0.046	6.945E-1	837	0.081	0.029	Q810B8.pdb.gz	SLIK4_MOUSE SLIT and NTRK-like protein 4 OS=Mus musculus OX=10090 GN=Slitrk4 PE=1 SV=2
7	AFDB:Q8R4I7	0.139	0.085	7.425E-1	533	0.078	0.043	Q8R4I7.pdb.gz	NETO1_MOUSE Neuropilin and tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Neto1 PE=1 SV=2
8	AFDB:Q80T91	0.121	0.041	8.488E-1	1091	0.125	0.034	Q80T91.pdb.gz	MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus OX=10090 GN=Megf11 PE=1 SV=3
9	AFDB:Q9FX63	0.108	0.079	8.488E-1	409	0.098	0.071	Q9FX63.pdb.gz	Q9FX63_ARATH Regulator of Vps4 activity in the MVB pathway protein OS=Arabidopsis thaliana OX=3702 GN=ISTL6 PE=1 SV=1
10	AFDB:K4DIA0	0.110	0.076	9.704E-1	473	0.122	0.076	K4DIA0.pdb.gz	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
11	PDB:1t9mA	0.065	0.085	3.748	204	0.024	0.034	1t9mA.pdb.gz	Structure of the phenazine biosynthesis enzyme PhzG.
12	PDB:4zpuA	0.050	0.082	4.898	165	0.024	0.042	4zpuA.pdb.gz
13	PDB:6tqnA	0.107	0.075	4.898	495	0.044	0.026	6tqnA.pdb.gz	Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.
14	PDB:6cesA	0.060	0.059	5.599	300	0.031	0.030	6cesA.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
15	PDB:6h3cA	0.082	0.092	6.844	255	0.054	0.063	6h3cA.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
16	PDB:6ovtA	0.056	0.030	6.844	562	0.010	0.005	6ovtA.pdb.gz	The active site of theMycobacterium tuberculosisbranched-chain amino acid biosynthesis enzyme dihydroxyacid dehydratase contains a 2Fe-2S cluster.
17	PDB:8a5xA	0.051	0.034	8.365	466	0.017	0.011	8a5xA.pdb.gz	Structure-based design and modular synthesis of novel PI4K class II inhibitors bearing a 4-aminoquinazoline scaffold.
18	PDB:3wsoA	0.056	0.063	8.944	252	0.017	0.020	3wsoA.pdb.gz
19	PDB:6edtJ	0.084	0.195	9.563	109	0.041	0.110	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
20	PDB:7e1vN	0.079	0.054	9.563	524	0.051	0.029	7e1vN.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UWI4	0.0	607	295	1.000	1.000	SHSA2_HUMAN Protein shisa-2 homolog OS=Homo sapiens OX=9606 GN=SHISA2 PE=1 SV=1
2	Q8QZV2	2.97e-167	467	295	0.925	0.925	SHSA2_MOUSE Protein shisa-2 homolog OS=Mus musculus OX=10090 GN=Shisa2 PE=2 SV=1
3	Q3UPR0	1.05e-56	184	238	0.390	0.483	SHSA3_MOUSE Protein shisa-3 homolog OS=Mus musculus OX=10090 GN=Shisa3 PE=1 SV=1
4	A0PJX4	7.31e-54	177	238	0.359	0.445	SHSA3_HUMAN Protein shisa-3 homolog OS=Homo sapiens OX=9606 GN=SHISA3 PE=1 SV=1
5	Q9CZN4	2.21e-08	57.0	424	0.112	0.078	SHSA9_MOUSE Protein shisa-9 OS=Mus musculus OX=10090 GN=Shisa9 PE=1 SV=2
6	Q8C3Q5	3.81e-06	50.4	558	0.071	0.038	SHSA7_MOUSE Protein shisa-7 OS=Mus musculus OX=10090 GN=Shisa7 PE=1 SV=3
7	Q3UH99	6.96e-06	49.7	525	0.115	0.065	SHSA6_MOUSE Protein shisa-6 OS=Mus musculus OX=10090 GN=Shisa6 PE=1 SV=1
8	Q6ZSJ9	1.07e-05	48.9	500	0.115	0.068	SHSA6_HUMAN Protein shisa-6 OS=Homo sapiens OX=9606 GN=SHISA6 PE=1 SV=2
9	Q96DD7	1.13e-04	44.7	197	0.159	0.239	SHSA4_HUMAN Protein shisa-4 OS=Homo sapiens OX=9606 GN=SHISA4 PE=1 SV=3
10	Q3SXP7	1.65e-04	44.3	199	0.075	0.111	SHSL1_HUMAN Protein shisa-like-1 OS=Homo sapiens OX=9606 GN=SHISAL1 PE=1 SV=2
11	Q9JKA5	5.82e-04	43.1	319	0.095	0.088	GPA33_MOUSE Cell surface A33 antigen OS=Mus musculus OX=10090 GN=Gpa33 PE=2 SV=2
12	Q9SA72	0.032	38.1	849	0.125	0.044	Y1357_ARATH Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana OX=3702 GN=At1g30570 PE=3 SV=1
13	Q8IPU7	1.7	32.0	177	0.061	0.102	Q8IPU7_DROME BNIP3, isoform C OS=Drosophila melanogaster OX=7227 GN=BNIP3 PE=2 SV=1
14	P08165	1.9	32.3	492	0.054	0.033	ADRO_BOVIN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Bos taurus OX=9913 GN=FDXR PE=1 SV=3
15	Q8IPU8	2.2	31.6	193	0.061	0.093	Q8IPU8_DROME BNIP3, isoform B OS=Drosophila melanogaster OX=7227 GN=BNIP3 PE=3 SV=1
16	Q5SUF5	2.9	32.3	2247	0.068	0.009	Q5SUF5_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
17	Q5SUF8	2.9	32.3	2254	0.068	0.009	Q5SUF8_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
18	Q5SUG2	2.9	32.3	2176	0.068	0.009	Q5SUG2_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
19	Q5SUG3	2.9	32.3	2270	0.068	0.009	Q5SUG3_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
20	Q80YT7	2.9	32.3	2224	0.098	0.013	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13908 Shisa	1.4e-53	193.4	Wnt and FGF inhibitory regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313079

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000273359	0.642	Mycophenolic acid acyl-glucuronide esterase, mitochondrial
2	9606.ENSP00000370508	0.642	Translation initiation factor IF-3, mitochondrial
3	9606.ENSP00000370532	0.552	Transcription factor IIIA
4	9606.ENSP00000377494	0.539	Transgelin-3
5	9606.ENSP00000355587	0.505	Cancer-related nucleoside-triphosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0023051	0.997	regulation of signaling
GO:0010646	0.997	regulation of cell communication
GO:0030111	0.994	regulation of Wnt signaling pathway
GO:0009968	0.994	negative regulation of signal transduction
GO:0090288	0.982	negative regulation of cellular response to growth factor stimulus
GO:0040036	0.981	regulation of fibroblast growth factor receptor signaling pathway
GO:0030178	0.928	negative regulation of Wnt signaling pathway
GO:0009987	0.444	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.996	endomembrane system
GO:0005783	0.983	endoplasmic reticulum
GO:0016020	0.696	membrane
GO:0005886	0.483	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]