StarFunc result for job id Q6UWJ1

User Input

>input (677 residues)
MKVLGRSFFWVLFPVLPWAVQAVEHEEVAQRVIKLHRGRGVAAMQSRQWVRDSCRKLSGL
LRQKNAVLNKLKTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRA
LQGDYKDVVNMKESSRQRLEALREAAIKEETEYMELLAAEKHQVEALKNMQHQNQSLSML
DEILEDVRKAADRLEEEIEEHAFDDNKSVKGVNFEAVLRVEEEEANSKQNITKREVEDDL
GLSMLIDSQNNQYILTKPRDSTIPRADHHFIKDIVTIGMLSLPCGWLCTAIGLPTMFGYI
ICGVLLGPSGLNSIKSIVQVETLGEFGVFFTLFLVGLEFSPEKLRKVWKISLQGPCYMTL
LMIAFGLLWGHLLRIKPTQSVFISTCLSLSSTPLVSRFLMGSARGDKEGDIDYSTVLLGM
LVTQDVQLGLFMAVMPTLIQAGASASSSIVVEVLRILVLIGQILFSLAAVFLLCLVIKKY
LIGPYYRKLHMESKGNKEILILGISAFIFLMLTVTELLDVSMELGCFLAGALVSSQGPVV
TEEIATSIEPIRDFLAIVFFASIGLHVFPTFVAYELTVLVFLTLSVVVMKFLLAALVLSL
ILPRSSQYIKWIVSAGLAQVSEFSFVLGSRARRAGVISREVYLLILSVTTLSLLLAPVLW
RAAITRCVPRPERRSSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ZUN3	0.621	0.705	1.350E-26	592	0.210	0.240	Q9ZUN3.pdb.gz	KEA4_ARATH K(+) efflux antiporter 4 OS=Arabidopsis thaliana OX=3702 GN=KEA4 PE=1 SV=2
2	AFDB:P39830	0.509	0.606	1.287E-18	558	0.136	0.165	P39830.pdb.gz	YBAL_ECOLI Putative cation/proton antiporter YbaL OS=Escherichia coli (strain K12) OX=83333 GN=ybaL PE=1 SV=2
3	AFDB:Q9M0Z3	0.509	0.447	8.679E-18	776	0.160	0.139	Q9M0Z3.pdb.gz	KEA3_ARATH K(+) efflux antiporter 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA3 PE=1 SV=2
4	AFDB:Q9ZTZ7	0.475	0.285	1.689E-17	1193	0.151	0.085	Q9ZTZ7.pdb.gz	KEA1_ARATH K(+) efflux antiporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA1 PE=1 SV=2
5	AFDB:P45522	0.519	0.581	1.845E-17	601	0.136	0.153	P45522.pdb.gz	KEFB_ECOLI Glutathione-regulated potassium-efflux system protein KefB OS=Escherichia coli (strain K12) OX=83333 GN=kefB PE=3 SV=1
6	AFDB:P03819	0.527	0.573	7.305E-17	620	0.130	0.142	P03819.pdb.gz	KEFC_ECOLI Glutathione-regulated potassium-efflux system protein KefC OS=Escherichia coli (strain K12) OX=83333 GN=kefC PE=1 SV=2
7	AFDB:F4JHE9	0.458	0.277	2.316E-16	1185	0.219	0.125	F4JHE9.pdb.gz	F4JHE9_ARATH K+ efflux antiporter 2 OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=1
8	AFDB:P26235	0.510	0.873	4.925E-16	383	0.127	0.225	P26235.pdb.gz	NAPA_ENTHR Na(+)/H(+) antiporter OS=Enterococcus hirae OX=1354 GN=napA PE=1 SV=1
9	AFDB:Q9KI10	0.460	0.743	4.925E-16	387	0.115	0.202	Q9KI10.pdb.gz	GERN_BACCE Na(+)/H(+)-K(+) antiporter GerN OS=Bacillus cereus OX=1396 GN=gerN PE=1 SV=1
10	AFDB:Q7NKY3	0.468	0.495	6.427E-16	634	0.134	0.144	Q7NKY3.pdb.gz	Q7NKY3_GLOVI Glr1343 protein OS=Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) OX=251221 GN=glr1343 PE=1 SV=1
11	PDB:4bwzA	0.491	0.832	1.297E-14	384	0.131	0.232	4bwzA.pdb.gz	A two-domain elevator mechanism for sodium/proton antiport.
12	PDB:7b4mA	0.438	0.616	7.552E-8	459	0.109	0.161	7b4mA.pdb.gz
13	PDB:4czbB	0.446	0.672	3.125E-7	419	0.089	0.143	4czbB.pdb.gz
14	PDB:4atvA	0.325	0.516	2.225E-4	381	0.081	0.144	4atvA.pdb.gz
15	PDB:7qp9A	0.307	0.558	3.982E-3	327	0.084	0.174	7qp9A.pdb.gz	Structures and mechanism of the plant PIN-FORMED auxin transporter.
16	PDB:7vadA	0.299	0.572	8.101E-3	306	0.069	0.154	7vadA.pdb.gz
17	PDB:7wkwB	0.317	0.519	1.155E-2	377	0.087	0.156	7wkwB.pdb.gz	Structures and mechanisms of the Arabidopsis auxin transporter PIN3.
18	PDB:7y9tA	0.315	0.513	7.451E-2	380	0.078	0.139	7y9tA.pdb.gz
19	PDB:6gs1A	0.088	0.110	9.724E-2	472	0.086	0.123	6gs1A.pdb.gz
20	PDB:5j4nA	0.089	0.117	1.327E-1	437	0.086	0.133	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ZUN3	3.85e-49	183	592	0.220	0.252	KEA4_ARATH K(+) efflux antiporter 4 OS=Arabidopsis thaliana OX=3702 GN=KEA4 PE=1 SV=2
2	P39830	2.85e-20	97.4	558	0.154	0.186	YBAL_ECOLI Putative cation/proton antiporter YbaL OS=Escherichia coli (strain K12) OX=83333 GN=ybaL PE=1 SV=2
3	P03819	2.16e-18	91.7	620	0.152	0.166	KEFC_ECOLI Glutathione-regulated potassium-efflux system protein KefC OS=Escherichia coli (strain K12) OX=83333 GN=kefC PE=1 SV=2
4	P45522	5.73e-17	87.0	601	0.146	0.165	KEFB_ECOLI Glutathione-regulated potassium-efflux system protein KefB OS=Escherichia coli (strain K12) OX=83333 GN=kefB PE=3 SV=1
5	Q9ZTZ7	2.27e-13	76.3	1193	0.151	0.085	KEA1_ARATH K(+) efflux antiporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA1 PE=1 SV=2
6	O65272	4.73e-13	75.1	1174	0.145	0.083	KEA2_ARATH K(+) efflux antiporter 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=2
7	Q9M0Z3	5.68e-13	74.7	776	0.149	0.130	KEA3_ARATH K(+) efflux antiporter 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA3 PE=1 SV=2
8	F4JHE9	9.09e-13	74.3	1185	0.151	0.086	F4JHE9_ARATH K+ efflux antiporter 2 OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=1
9	Q7NKY3	2.65e-10	65.9	634	0.155	0.166	Q7NKY3_GLOVI Glr1343 protein OS=Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) OX=251221 GN=glr1343 PE=1 SV=1
10	Q72IM4	6.80e-10	63.9	386	0.151	0.264	Q72IM4_THET2 Na(+)/H(+) antiporter OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=TT_C1108 PE=1 SV=1
11	Q9SUQ7	6.45e-06	52.0	820	0.097	0.080	CHX17_ARATH Cation/H(+) antiporter 17 OS=Arabidopsis thaliana OX=3702 GN=CHX17 PE=1 SV=1
12	P26235	3.22e-05	49.3	383	0.044	0.078	NAPA_ENTHR Na(+)/H(+) antiporter OS=Enterococcus hirae OX=1354 GN=napA PE=1 SV=1
13	Q9KI10	6.16e-05	48.1	387	0.123	0.214	GERN_BACCE Na(+)/H(+)-K(+) antiporter GerN OS=Bacillus cereus OX=1396 GN=gerN PE=1 SV=1
14	P40309	0.086	38.5	873	0.137	0.107	KHA1_YEAST K(+)/H(+) antiporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KHA1 PE=1 SV=1
15	Q7D5V5	0.17	37.4	385	0.096	0.169	Q7D5V5_MYCTO Cation/proton antiporter, putative OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3333 PE=4 SV=1
16	Q9SIT5	0.29	37.0	821	0.052	0.043	CHX15_ARATH Cation/H(+) antiporter 15 OS=Arabidopsis thaliana OX=3702 GN=CHX15 PE=2 SV=1
17	Q9FFR9	0.30	37.0	810	0.120	0.100	CHX18_ARATH Cation/H(+) antiporter 18 OS=Arabidopsis thaliana OX=3702 GN=CHX18 PE=2 SV=1
18	P54697	0.37	36.6	2245	0.050	0.015	MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoJ PE=3 SV=2
19	Q8IDX6	0.47	36.2	3130	0.077	0.017	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
20	Q8IHN4	1.7	34.7	6093	0.044	0.005	Q8IHN4_PLAF7 Antigen 332, DBL-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1149000 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00999 Na_H_Exchanger	2.4e-68	242.3	Sodium/hydrogen exchanger family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389399

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222481	0.587	M14 carboxypeptidases
2	9606.ENSP00000273398	0.549	V-type proton ATPase catalytic subunit A
3	9606.ENSP00000266534	0.543	Transmembrane protein 117
4	9606.ENSP00000319788	0.528	NAD(P)H dehydrogenase [quinone] 1
5	9606.ENSP00000369822	0.528	Ribosyldihydronicotinamide dehydrogenase [quinone]
6	9606.ENSP00000405635	0.522	CTD nuclear envelope phosphatase 1 regulatory subunit 1
7	9606.ENSP00000371253	0.520	Trifunctional purine biosynthetic protein adenosine-3
8	9606.ENSP00000353470	0.517	Uncharacterized protein C20orf96
9	9606.ENSP00000400471	0.506	Transmembrane protein 106C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	0.999	salt transmembrane transporter activity
GO:0015291	0.999	secondary active transmembrane transporter activity
GO:0046873	0.999	metal ion transmembrane transporter activity
GO:0005515	0.996	protein binding
GO:0015297	0.989	antiporter activity
GO:0022853	0.986	active monoatomic ion transmembrane transporter activity
GO:0015078	0.938	proton transmembrane transporter activity
GO:0140828	0.906	metal cation:monoatomic cation antiporter activity
GO:0051139	0.849	metal cation:proton antiporter activity
GO:0015385	0.840	sodium:proton antiporter activity
GO:0015079	0.577	potassium ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051234	0.977	establishment of localization
GO:0006811	0.923	monoatomic ion transport
GO:0065007	0.873	biological regulation
GO:0050896	0.580	response to stimulus
GO:0050789	0.537	regulation of biological process
GO:0008152	0.534	metabolic process
GO:0006812	0.490	monoatomic cation transport
GO:0071704	0.479	organic substance metabolic process
GO:0050794	0.460	regulation of cellular process
GO:0050801	0.363	monoatomic ion homeostasis
GO:0044238	0.341	primary metabolic process
GO:0030001	0.338	metal ion transport
GO:0055080	0.327	monoatomic cation homeostasis
GO:0006807	0.320	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.972	membrane
GO:0031090	0.923	organelle membrane
GO:0031984	0.455	organelle subcompartment
GO:0031982	0.368	vesicle
GO:0042175	0.330	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0071944	0.327	cell periphery
GO:0005789	0.311	endoplasmic reticulum membrane
GO:0005794	0.308	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29251	0.840	2 H(+)(out) + Na(+)(in) = 2 H(+)(in) + Na(+)(out)
RHEA:29463	0.577	K(+)(in) = K(+)(out)

[back to server]