StarFunc result for job id Q6UWL2

User Input

>input (747 residues)
MGRGPWDAGPSRRLLPLLLLLGLARGAAGAPGPDGLDVCATCHEHATCQQREGKKICICN
YGFVGNGRTQCVDKNECQFGATLVCGNHTSCHNTPGGFYCICLEGYRATNNNKTFIPNDG
TFCTDIDECEVSGLCRHGGRCVNTHGSFECYCMDGYLPRNGPEPFHPTTDATSCTEIDCG
TPPEVPDGYIIGNYTSSLGSQVRYACREGFFSVPEDTVSSCTGLGTWESPKLHCQEINCG
NPPEMRHAILVGNHSSRLGGVARYVCQEGFESPGGKITSVCTEKGTWRESTLTCTEILTK
INDVSLFNDTCVRWQINSRRINPKISYVISIKGQRLDPMESVREETVNLTTDSRTPEVCL
ALYPGTNYTVNISTAPPRRSMPAVIGFQTAEVDLLEDDGSFNISIFNETCLKLNRRSRKV
GSEHMYQFTVLGQRWYLANFSHATSFNFTTREQVPVVCLDLYPTTDYTVNVTLLRSPKRH
SVQITIATPPAVKQTISNISGFNETCLRWRSIKTADMEEMYLFHIWGQRWYQKEFAQEMT
FNISSSSRDPEVCLDLRPGTNYNVSLRALSSELPVVISLTTQITEPPLPEVEFFTVHRGP
LPRLRLRKAKEKNGPISSYQVLVLPLALQSTFSCDSEGASSFFSNASDADGYVAAELLAK
DVPDDAMEIPIGDRLYYGEYYNAPLKRGSDYCIILRITSEWNKVRRHSCAVWAQVKDSSL
MLLQMAGVGLGSLAVVIILTFLSFSAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TER0	0.125	0.079	2.531E-20	1413	0.167	0.088	Q8TER0.pdb.gz	SNED1_HUMAN Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNED1 PE=1 SV=2
2	AFDB:Q70E20	0.160	0.095	1.526E-19	1403	0.175	0.093	Q70E20.pdb.gz	SNED1_MOUSE Sushi, nidogen and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sned1 PE=2 SV=2
3	AFDB:B3DK56	0.253	0.145	2.311E-18	1444	0.118	0.061	B3DK56.pdb.gz	PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio OX=7955 GN=ptpru PE=2 SV=1
4	AFDB:B1AUH1	0.243	0.138	2.779E-18	1446	0.123	0.064	B1AUH1.pdb.gz	PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus OX=10090 GN=Ptpru PE=1 SV=1
5	AFDB:P35822	0.261	0.146	1.459E-17	1457	0.119	0.061	P35822.pdb.gz	PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus OX=10090 GN=Ptprk PE=1 SV=1
6	AFDB:P28827	0.241	0.134	2.014E-17	1452	0.124	0.064	P28827.pdb.gz	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
7	AFDB:F1QJW2	0.129	0.075	5.063E-16	1918	0.119	0.046	F1QJW2.pdb.gz
8	AFDB:F1NWE3	0.144	0.085	7.319E-16	1516	0.116	0.057	F1NWE3.pdb.gz	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
9	AFDB:P16621	0.240	0.097	7.319E-16	2029	0.131	0.048	P16621.pdb.gz	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
10	AFDB:Q64455	0.210	0.146	8.025E-16	1238	0.170	0.103	Q64455.pdb.gz	PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2
11	PDB:2q7zA	0.094	0.051	3.735E-9	1931	0.139	0.054	2q7zA.pdb.gz
12	PDB:1c1zA	0.188	0.366	1.557E-8	326	0.072	0.166	1c1zA.pdb.gz
13	PDB:2gsxA	0.124	0.103	1.961E-8	951	0.116	0.091	2gsxA.pdb.gz
14	PDB:7q5zA	0.169	0.113	6.801E-8	1344	0.107	0.060	7q5zA.pdb.gz
15	PDB:5a42A	0.123	0.068	8.176E-8	1597	0.088	0.041	5a42A.pdb.gz
16	PDB:7q1yA	0.163	0.109	8.176E-8	1374	0.103	0.056	7q1yA.pdb.gz
17	PDB:6pxvA	0.164	0.151	1.182E-7	823	0.068	0.062	6pxvA.pdb.gz
18	PDB:8dtlA	0.159	0.160	1.558E-7	741	0.062	0.062	8dtlA.pdb.gz
19	PDB:8eyyA	0.167	0.161	1.789E-7	775	0.071	0.068	8eyyA.pdb.gz
20	PDB:4rtdA	0.129	0.092	2.586E-7	1122	0.067	0.045	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ESC1	3.23e-27	120	738	0.076	0.077	AGRL4_RAT Adhesion G protein-coupled receptor L4 OS=Rattus norvegicus OX=10116 GN=Adgrl4 PE=1 SV=1
2	P07911	9.54e-18	90.1	640	0.068	0.080	UROM_HUMAN Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1
3	Q9HBW9	8.46e-16	84.0	690	0.056	0.061	AGRL4_HUMAN Adhesion G protein-coupled receptor L4 OS=Homo sapiens OX=9606 GN=ADGRL4 PE=1 SV=3
4	Q9UHX3	1.51e-14	80.1	823	0.084	0.077	AGRE2_HUMAN Adhesion G protein-coupled receptor E2 OS=Homo sapiens OX=9606 GN=ADGRE2 PE=1 SV=2
5	Q9NQ36	1.81e-14	80.1	999	0.086	0.064	SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCUBE2 PE=1 SV=3
6	P48960	3.64e-14	79.0	835	0.082	0.073	AGRE5_HUMAN Adhesion G protein-coupled receptor E5 OS=Homo sapiens OX=9606 GN=ADGRE5 PE=1 SV=4
7	A0A8I6A897	4.35e-14	79.0	2813	0.092	0.025	A0A8I6A897_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
8	A0A8I6G7Y9	5.97e-14	78.6	2861	0.092	0.024	A0A8I6G7Y9_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
9	Q14246	6.42e-14	78.2	886	0.080	0.068	AGRE1_HUMAN Adhesion G protein-coupled receptor E1 OS=Homo sapiens OX=9606 GN=ADGRE1 PE=2 SV=3
10	Q91X17	7.09e-14	77.8	642	0.074	0.086	UROM_MOUSE Uromodulin OS=Mus musculus OX=10090 GN=Umod PE=1 SV=1
11	G3V9M6	8.32e-14	78.2	2872	0.092	0.024	G3V9M6_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
12	O08999	1.45e-13	77.4	1813	0.096	0.040	LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus OX=10090 GN=Ltbp2 PE=1 SV=2
13	P35555	2.21e-13	76.6	2871	0.091	0.024	FBN1_HUMAN Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4
14	A2AVA0	2.23e-13	77.0	3567	0.099	0.021	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
15	Q8IX30	3.35e-13	75.9	993	0.070	0.052	SCUB3_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCUBE3 PE=1 SV=1
16	M9NCR4	3.78e-13	76.3	15105	0.062	0.003	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PCJ8	3.78e-13	76.3	14825	0.062	0.003	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9NER8	4.12e-13	76.3	15638	0.060	0.003	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	Q6NZL8	4.27e-13	75.5	1018	0.090	0.066	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
20	Q9JJS0	5.33e-13	75.1	997	0.083	0.062	SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus OX=10090 GN=Scube2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	0.00018	32.6	Complement Clr-like EGF-like
2	PF00008 EGF	3.5	19.3	EGF-like domain
3	PF12947 EGF_3	2.2e-07	42.2	EGF domain
4	PF07645 EGF_CA	8.2e-14	62.9	Calcium-binding EGF domain
5	PF12946 EGF_MSP1_1	1.4e+02	13.9	MSP1 EGF domain 1
6	PF00041 fn3	0.026	26.2	Fibronectin type III domain
7	PF14670 FXa_inhibition	24	16.7	Coagulation Factor Xa inhibitory site
8	PF12661 hEGF	22	17.1	Human growth factor-like EGF
9	PF18861 PTP_tm	1.6e+02	14.0	TM proximal of protein tyrosine phosphatase, receptor type J
10	PF00084 Sushi	7.8e-09	47.2	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363345	0.752	Thymic stromal cotransporter homolog
2	9606.ENSP00000363894	0.745	Nipsnap homolog 3B
3	9606.ENSP00000440190	0.730	Tudor domain-containing protein 3
4	9606.ENSP00000332663	0.703	Family with sequence similarity 65, member C
5	9606.ENSP00000357080	0.609	V-set and immunoglobulin domain containing 8
6	9606.ENSP00000357082	0.609	Putative uncharacterized protein SNHG28
7	9606.ENSP00000277225	0.587	Zinc finger protein 462
8	9606.ENSP00000311679	0.576	Zinc finger protein 483
9	9606.ENSP00000363899	0.556	Nipsnap homolog 3A
10	9606.ENSP00000363714	0.540	Belongs to the autoinducer-2 exporter (AI-2E) (TC 2.A.86) family
11	9606.ENSP00000371824	0.517	Uncharacterized protein C9orf66
12	9606.ENSP00000295588	0.514	Protein O-glucosyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004888	0.583	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.969	biological regulation
GO:0050789	0.958	regulation of biological process
GO:0009987	0.824	cellular process
GO:0050794	0.760	regulation of cellular process
GO:0032501	0.388	multicellular organismal process
GO:0048518	0.309	positive regulation of biological process
GO:0032502	0.305	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.995	cell periphery
GO:0016020	0.977	membrane
GO:0043226	0.958	organelle
GO:0005886	0.942	plasma membrane
GO:0043227	0.917	membrane-bounded organelle
GO:0005576	0.795	extracellular region
GO:0043231	0.724	intracellular membrane-bounded organelle
GO:0005737	0.473	cytoplasm
GO:0005615	0.385	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]