StarFunc result for job id Q6UWL6

User Input

>input (708 residues)
MLRMRVPALLVLLFCFRGRAGPSPHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSG
LALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVL
VPPEAPQVLGGPSVSLVAGVPANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEG
TPGSVESTLTLTPFSHDDGATFVCRARSQALPTGRDTAITLSLQYPPEVTLSASPHTVQE
GEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADASFLTEPVSCEVSNAVGSA
NRSTALDVLFGPILQAKPEPVSVDVGEDASFSCAWRGNPLPRVTWTRRGGAQVLGSGATL
RLPSVGPEDAGDYVCRAEAGLSGLRGGAAEARLTVNAPPVVTALHSAPAFLRGPARLQCL
VFASPAPDAVVWSWDEGFLEAGSQGRFLVETFPAPESRGGLGPGLISVLHISGTQESDFS
RSFNCSARNRLGEGGAQASLGRRDLLPTVRIVAGVAAATTTLLMVITGVALCCWRHSKAS
ASFSEQKNLMRIPGSSDGSSSRGPEEEETGSREDRGPIVHTDHSDLVLEEKGTLETKDPT
NGYYKVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAG
YLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UWL6	1.000	1.000	0.000	708	1.000	1.000	Q6UWL6.pdb.gz	KIRR2_HUMAN Kin of IRRE-like protein 2 OS=Homo sapiens OX=9606 GN=KIRREL2 PE=1 SV=3
2	AFDB:Q7TSU7	0.746	0.754	0.000	700	0.838	0.847	Q7TSU7.pdb.gz	KIRR2_MOUSE Kin of IRRE-like protein 2 OS=Mus musculus OX=10090 GN=Kirrel2 PE=1 SV=1
3	AFDB:B0CM22	0.525	0.489	4.047E-70	769	0.427	0.393	B0CM22.pdb.gz
4	AFDB:B3DHL7	0.609	0.550	1.044E-64	790	0.387	0.347	B3DHL7.pdb.gz	B3DHL7_DANRE Kirre like nephrin family adhesion molecule 1b precursor OS=Danio rerio OX=7955 GN=si:ch211-195h23.2 PE=2 SV=1
5	AFDB:Q6NY23	0.595	0.527	2.289E-64	807	0.373	0.327	Q6NY23.pdb.gz	Q6NY23_DANRE Kin of IRRE like (Drosophila) OS=Danio rerio OX=7955 GN=kirrel PE=1 SV=1
6	AFDB:Q8BR86	0.466	0.430	8.273E-61	778	0.367	0.334	Q8BR86.pdb.gz	KIRR3_MOUSE Kin of IRRE-like protein 3 OS=Mus musculus OX=10090 GN=Kirrel3 PE=1 SV=1
7	AFDB:Q9VQW7	0.344	0.202	3.108E-29	1332	0.158	0.084	Q9VQW7.pdb.gz	Q9VQW7_DROME Echinoid, isoform A OS=Drosophila melanogaster OX=7227 GN=ed PE=1 SV=2
8	AFDB:Q9BWV1	0.191	0.130	2.139E-23	1114	0.198	0.126	Q9BWV1.pdb.gz	BOC_HUMAN Brother of CDO OS=Homo sapiens OX=9606 GN=BOC PE=1 SV=1
9	AFDB:Q2EY14	0.200	0.130	5.706E-23	1149	0.216	0.133	Q2EY14.pdb.gz	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
10	PDB:5oj2B	0.194	0.198	7.457E-20	692	0.136	0.139	5oj2B.pdb.gz
11	PDB:1e07A	0.239	0.258	1.348E-18	642	0.121	0.134	1e07A.pdb.gz
12	AFDB:O88690	0.198	0.160	1.634E-15	946	0.161	0.121	O88690.pdb.gz	O88690_MOUSE CNR2 OS=Mus musculus OX=10090 GN=Pcdha6 PE=2 SV=1
13	PDB:2rcjC	0.188	0.214	4.871E-15	523	0.136	0.184	2rcjC.pdb.gz
14	PDB:6dldD	0.243	0.591	1.586E-13	269	0.079	0.208	6dldD.pdb.gz
15	PDB:7sqcO0	0.173	0.122	3.836E-13	1140	0.107	0.067	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:1hzhH	0.162	0.215	3.321E-12	457	0.116	0.179	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
17	PDB:4rtdA	0.144	0.099	4.458E-12	1122	0.097	0.061	4rtdA.pdb.gz
18	PDB:5a42A	0.132	0.076	2.142E-11	1597	0.103	0.046	5a42A.pdb.gz
19	PDB:4ziqA	0.141	0.080	1.136E-10	1450	0.099	0.048	4ziqA.pdb.gz
20	PDB:7q1yA	0.136	0.085	1.316E-10	1374	0.088	0.045	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UWL6	0.0	1417	708	0.999	0.999	KIRR2_HUMAN Kin of IRRE-like protein 2 OS=Homo sapiens OX=9606 GN=KIRREL2 PE=1 SV=3
2	Q7TSU7	0.0	1179	700	0.839	0.849	KIRR2_MOUSE Kin of IRRE-like protein 2 OS=Mus musculus OX=10090 GN=Kirrel2 PE=1 SV=1
3	A0A0R4IT86	5.57e-176	523	755	0.419	0.393	A0A0R4IT86_DANRE Kin of IRRE-like protein 2 precursor OS=Danio rerio OX=7955 GN=cb33 PE=4 SV=1
4	Q8BR86	8.18e-147	448	778	0.355	0.323	KIRR3_MOUSE Kin of IRRE-like protein 3 OS=Mus musculus OX=10090 GN=Kirrel3 PE=1 SV=1
5	Q8IZU9	1.40e-146	448	778	0.356	0.324	KIRR3_HUMAN Kin of IRRE-like protein 3 OS=Homo sapiens OX=9606 GN=KIRREL3 PE=1 SV=1
6	Q96J84	4.24e-146	446	757	0.340	0.318	KIRR1_HUMAN Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606 GN=KIRREL1 PE=1 SV=2
7	Q6X936	5.98e-145	444	789	0.356	0.319	KIRR1_RAT Kin of IRRE-like protein 1 OS=Rattus norvegicus OX=10116 GN=Kirrel1 PE=1 SV=2
8	Q80W68	6.17e-145	444	789	0.355	0.318	KIRR1_MOUSE Kin of IRRE-like protein 1 OS=Mus musculus OX=10090 GN=Kirrel1 PE=1 SV=1
9	B3DHL7	5.71e-135	418	790	0.390	0.349	B3DHL7_DANRE Kirre like nephrin family adhesion molecule 1b precursor OS=Danio rerio OX=7955 GN=si:ch211-195h23.2 PE=2 SV=1
10	Q6NY23	7.39e-133	413	807	0.357	0.314	Q6NY23_DANRE Kin of IRRE like (Drosophila) OS=Danio rerio OX=7955 GN=kirrel PE=1 SV=1
11	Q8MSN7	8.58e-71	242	551	0.216	0.278	Q8MSN7_DROME AT15038p OS=Drosophila melanogaster OX=7227 GN=kirre PE=2 SV=1
12	Q9W4T9	1.43e-68	244	956	0.225	0.166	Q9W4T9_DROME Kin of irre, isoform A OS=Drosophila melanogaster OX=7227 GN=kirre PE=1 SV=2
13	Q9N9Y9	1.88e-68	244	959	0.225	0.166	Q9N9Y9_DROME Dumbfounded OS=Drosophila melanogaster OX=7227 GN=kirre PE=1 SV=2
14	O97174	7.97e-64	231	975	0.222	0.161	O97174_DROME EG:163A10.1 protein OS=Drosophila melanogaster OX=7227 GN=kirre PE=1 SV=1
15	Q08180	3.53e-61	221	764	0.220	0.204	ICCR_DROME Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2
16	B1Q236	5.59e-50	188	730	0.213	0.207	SYG1_CAEEL Synaptogenesis protein syg-1 OS=Caenorhabditis elegans OX=6239 GN=syg-1 PE=1 SV=1
17	A0A0B4LEH1	1.89e-27	121	1492	0.155	0.074	A0A0B4LEH1_DROME Sticks and stones, isoform C OS=Drosophila melanogaster OX=7227 GN=sns PE=4 SV=1
18	A1Z7J1	2.04e-27	121	1479	0.155	0.074	A1Z7J1_DROME Sticks and stones, isoform A OS=Drosophila melanogaster OX=7227 GN=sns PE=4 SV=1
19	Q9V4Y0	2.09e-27	121	1482	0.155	0.074	Q9V4Y0_DROME SNS OS=Drosophila melanogaster OX=7227 GN=sns PE=2 SV=2
20	Q0E9F2	2.56e-27	121	1542	0.155	0.071	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	6.1e+02	12.2	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	2e-10	51.9	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	1.4e-29	113.3	Immunoglobulin I-set domain
4	PF00047 ig	3.7e-19	80.0	Immunoglobulin domain
5	PF13895 Ig_2	4.2e-23	92.8	Immunoglobulin domain
6	PF13927 Ig_3	6.5e-43	156.5	Immunoglobulin domain
7	PF18452 Ig_6	7.3e+02	11.4	Immunoglobulin domain
8	PF16706 Izumo-Ig	5.2e+02	12.0	Izumo-like Immunoglobulin domain
9	PF06066 SepZ	69	15.1	SepZ
10	PF07686 V-set	9.1e-10	50.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353331

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368190	0.802	Nephrin
2	9606.ENSP00000394485	0.771	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
3	9606.ENSP00000356587	0.770	Podocin
4	9606.ENSP00000398655	0.742	Tyrosine-protein kinase ITK/TSK
5	9606.ENSP00000480763	0.686	Ephrin type-A receptor 5
6	9606.ENSP00000328478	0.630	Cyclic nucleotide-gated olfactory channel
7	9606.ENSP00000483333	0.612	SKI family transcriptional corepressor 2
8	9606.ENSP00000337443	0.603	Nucleoredoxin
9	9606.ENSP00000221859	0.588	DNA-directed RNA polymerase II subunit RPB9
10	9606.ENSP00000292907	0.576	Cytochrome c oxidase subunit 7A1, mitochondrial
11	9606.ENSP00000328777	0.558	Ephrin-A5
12	9606.ENSP00000376345	0.540	Growth factor receptor-bound protein 2
13	9606.ENSP00000382428	0.538	Disks large homolog 4
14	9606.ENSP00000365687	0.531	Pancreas transcription factor 1 subunit alpha
15	9606.ENSP00000356562	0.526	Xenotropic and polytropic retrovirus receptor 1
16	9606.ENSP00000314724	0.520	Liprin-beta-1
17	9606.ENSP00000258484	0.518	Enhancer of polycomb homolog 2
18	9606.ENSP00000221891	0.513	Amyloid-like protein 1
19	9606.ENSP00000345985	0.507	Leucine-rich repeat and fibronectin type-III domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.842	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0007155	0.646	cell adhesion
GO:0080090	0.631	regulation of primary metabolic process
GO:0051171	0.626	regulation of nitrogen compound metabolic process
GO:0048519	0.600	negative regulation of biological process
GO:0031323	0.598	regulation of cellular metabolic process
GO:0060255	0.595	regulation of macromolecule metabolic process
GO:0031399	0.586	regulation of protein modification process
GO:0048523	0.585	negative regulation of cellular process
GO:0071840	0.508	cellular component organization or biogenesis
GO:0051174	0.487	regulation of phosphorus metabolic process
GO:0010605	0.468	negative regulation of macromolecule metabolic process
GO:0032501	0.429	multicellular organismal process
GO:0016043	0.415	cellular component organization
GO:0048856	0.412	anatomical structure development
GO:0051248	0.391	negative regulation of protein metabolic process
GO:0031400	0.377	negative regulation of protein modification process
GO:0050896	0.355	response to stimulus
GO:0048518	0.334	positive regulation of biological process
GO:0007275	0.327	multicellular organism development
GO:0019220	0.315	regulation of phosphate metabolic process
GO:0048731	0.306	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.574	organelle
GO:0043227	0.524	membrane-bounded organelle
GO:0030054	0.522	cell junction
GO:0005622	0.395	intracellular anatomical structure
GO:0043231	0.332	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]