StarFunc result for job id Q6UWR7

User Input

>input (440 residues)
MAVKLGTLLLALALGLAQPASARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKV
DYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS
EPLWVTLTKAKRKVYMYYWPGCEVEILGVRPTYCLEYKNVPTDINFANAVSDALDSFKSG
RADLAAIYHERIDVEGHHYGPASPQRKDALKAVDTVLKYMTKWIQERGLQDRLNVIIFSD
HGMTDIFWMDKVIELNKYISLNDLQQVKDRGPVVSLWPAPGKHSEIYNKLSTVEHMTVYE
KEAIPSRFYYKKGKFVSPLTLVADEGWFITENREMLPFWMNSTGRREGWQRGWHGYDNEL
MDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWSRVMCMLKGRAST
APPVWPSHCALALILLFLLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UWR7	1.000	1.000	1.017E-99	440	1.000	1.000	Q6UWR7.pdb.gz	ENPP6_HUMAN Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Homo sapiens OX=9606 GN=ENPP6 PE=1 SV=2
2	AFDB:Q8BGN3	0.928	0.928	6.570E-91	440	0.861	0.861	Q8BGN3.pdb.gz	ENPP6_MOUSE Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Mus musculus OX=10090 GN=Enpp6 PE=1 SV=1
3	AFDB:P84039	0.855	0.791	7.841E-47	477	0.330	0.304	P84039.pdb.gz	ENPP5_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Rattus norvegicus OX=10116 GN=Enpp5 PE=1 SV=2
4	AFDB:Q6UWV6	0.850	0.818	5.352E-46	458	0.302	0.290	Q6UWV6.pdb.gz	ENPP7_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Homo sapiens OX=9606 GN=ENPP7 PE=1 SV=4
5	AFDB:Q9UJA9	0.833	0.770	6.804E-46	477	0.325	0.300	Q9UJA9.pdb.gz	ENPP5_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Homo sapiens OX=9606 GN=ENPP5 PE=1 SV=1
6	AFDB:Q3TIW9	0.837	0.838	1.288E-44	439	0.307	0.308	Q3TIW9.pdb.gz	ENPP7_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Mus musculus OX=10090 GN=Enpp7 PE=1 SV=1
7	AFDB:Q9Y6X5	0.809	0.787	3.794E-44	453	0.323	0.313	Q9Y6X5.pdb.gz	ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3
8	PDB:5venA	0.814	0.934	6.495E-44	382	0.318	0.366	5venA.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
9	PDB:5vemB	0.805	0.922	9.108E-43	383	0.311	0.358	5vemB.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
10	AFDB:Q22129	0.827	0.785	1.206E-41	465	0.250	0.237	Q22129.pdb.gz	Q22129_CAEEL Choline-specific glycerophosphodiester phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=CELE_T03G6.3 PE=1 SV=2
11	PDB:6wevAbA	0.808	0.444	8.210E-41	817	0.293	0.158	6wevAbA.pdb.gz	Crystal structures of human ENPP1 in apo and bound forms.
12	AFDB:P97675	0.793	0.407	2.025E-40	875	0.268	0.135	P97675.pdb.gz	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
13	AFDB:O14638	0.798	0.410	2.903E-40	875	0.264	0.133	O14638.pdb.gz	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
14	PDB:6c01A	0.799	0.436	5.604E-40	819	0.266	0.143	6c01A.pdb.gz	Structural basis for nucleotide recognition by the ectoenzyme CD203c.
15	PDB:6xkdB	0.801	0.525	1.464E-39	681	0.286	0.185	6xkdB.pdb.gz	Structure-Aided Development of Small-Molecule Inhibitors of ENPP1, the Extracellular Phosphodiesterase of the Immunotransmitter cGAMP.
16	PDB:4b56A	0.803	0.441	2.366E-39	816	0.282	0.152	4b56A.pdb.gz	Structure of Npp1, an Ectonucleotide Pyrophosphatase/Phosphodiesterase Involved in Tissue Calcification.
17	PDB:5s9mA	0.761	0.423	1.341E-35	809	0.243	0.132	5s9mA.pdb.gz	Crystal Structure of a rat Autotaxin complex
18	PDB:3wayA	0.746	0.425	7.200E-35	787	0.241	0.135	3wayA.pdb.gz	Screening and X-ray Crystal Structure-based Optimization of Autotaxin (ENPP2) Inhibitors, Using a Newly Developed Fluorescence Probe
19	PDB:6g4gC	0.709	0.431	4.429E-32	742	0.232	0.137	6g4gC.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
20	PDB:6g4gD	0.720	0.417	4.429E-32	781	0.236	0.133	6g4gD.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UWR7	0.0	915	440	1.000	1.000	ENPP6_HUMAN Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Homo sapiens OX=9606 GN=ENPP6 PE=1 SV=2
2	Q8BGN3	0.0	803	440	0.861	0.861	ENPP6_MOUSE Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Mus musculus OX=10090 GN=Enpp6 PE=1 SV=1
3	P84039	2.56e-74	242	477	0.330	0.304	ENPP5_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Rattus norvegicus OX=10116 GN=Enpp5 PE=1 SV=2
4	Q9EQG7	1.53e-73	240	477	0.345	0.319	ENPP5_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Mus musculus OX=10090 GN=Enpp5 PE=1 SV=3
5	Q9UJA9	1.15e-71	235	477	0.336	0.310	ENPP5_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Homo sapiens OX=9606 GN=ENPP5 PE=1 SV=1
6	Q9Y6X5	2.18e-67	223	453	0.318	0.309	ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3
7	Q3TIW9	3.65e-63	212	439	0.316	0.317	ENPP7_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Mus musculus OX=10090 GN=Enpp7 PE=1 SV=1
8	Q6UWV6	1.60e-62	211	458	0.300	0.288	ENPP7_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Homo sapiens OX=9606 GN=ENPP7 PE=1 SV=4
9	Q5EZ72	9.03e-60	203	439	0.314	0.314	ENPP7_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Rattus norvegicus OX=10116 GN=Enpp7 PE=1 SV=1
10	B2RBY8	2.42e-55	199	873	0.307	0.155	B2RBY8_HUMAN cDNA, FLJ95771, highly similar to Homo sapiens ectonucleotide pyrophosphatase/phosphodiesterase 1 (ENPP1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
11	P22413	4.10e-55	198	925	0.307	0.146	ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2
12	P06802	7.63e-55	197	906	0.305	0.148	ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus OX=10090 GN=Enpp1 PE=1 SV=4
13	Q924C3	2.62e-54	196	906	0.302	0.147	ENPP1_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Rattus norvegicus OX=10116 GN=Enpp1 PE=1 SV=2
14	P97675	8.46e-54	194	875	0.300	0.151	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
15	B0JZL7	4.99e-53	192	878	0.289	0.145	B0JZL7_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Danio rerio OX=7955 GN=si:ch211-142e24.2 PE=1 SV=1
16	O14638	2.59e-52	190	875	0.284	0.143	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
17	Q6DYE8	1.38e-51	188	874	0.282	0.142	ENPP3_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Mus musculus OX=10090 GN=Enpp3 PE=1 SV=2
18	Q64610	1.89e-49	182	887	0.259	0.129	ENPP2_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Rattus norvegicus OX=10116 GN=Enpp2 PE=1 SV=2
19	Q9R1E6	4.49e-49	181	862	0.264	0.135	ENPP2_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Mus musculus OX=10090 GN=Enpp2 PE=1 SV=3
20	Q9SU81	8.26e-49	174	461	0.282	0.269	Q9SU81_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29700 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01676 Metalloenzyme	11	16.9	Metalloenzyme superfamily
2	PF08665 PglZ	1.1e+02	14.3	PglZ domain
3	PF01663 Phosphodiest	4.7e-76	268.3	Type I phosphodiesterase / nucleotide pyrophosphatase
4	PF00884 Sulfatase	4.6e+02	11.6	Sulfatase
5	PF02201 SWIB	86	14.4	SWIB/MDM2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296741

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321038	0.958	Lysoplasmalogenase
2	9606.ENSP00000317300	0.926	Lysophospholipid acyltransferase LPCAT4
3	9606.ENSP00000284116	0.911	Lysophospholipase D GDPD1
4	9606.ENSP00000384363	0.903	Lysophospholipase D GDPD3
5	9606.ENSP00000382434	0.717	Cytosolic phospholipase A2 epsilon
6	9606.ENSP00000472546	0.662	Cytosolic phospholipase A2 gamma
7	9606.ENSP00000362123	0.659	Group XIIB secretory phospholipase A2-like protein
8	9606.ENSP00000333142	0.656	85/88 kDa calcium-independent phospholipase A2
9	9606.ENSP00000215885	0.650	Group 3 secretory phospholipase A2
10	9606.ENSP00000243501	0.650	Group XIIA secretory phospholipase A2
11	9606.ENSP00000247992	0.650	Putative inactive group IIC secretory phospholipase A2
12	9606.ENSP00000290472	0.650	Cytosolic phospholipase A2 delta
13	9606.ENSP00000312286	0.650	Phospholipase A2
14	9606.ENSP00000320337	0.650	HRAS-like suppressor 3
15	9606.ENSP00000330442	0.650	Phospholipase B1, membrane-associated
16	9606.ENSP00000356436	0.650	Cytosolic phospholipase A2
17	9606.ENSP00000364243	0.650	Group IIF secretory phospholipase A2
18	9606.ENSP00000364246	0.650	Group IID secretory phospholipase A2
19	9606.ENSP00000364249	0.650	Calcium-dependent phospholipase A2
20	9606.ENSP00000364257	0.650	Group IIE secretory phospholipase A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0008081	0.999	phosphoric diester hydrolase activity
GO:0005515	0.991	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0006629	0.960	lipid metabolic process
GO:0097164	0.958	ammonium ion metabolic process
GO:1901564	0.954	organonitrogen compound metabolic process
GO:0044255	0.954	cellular lipid metabolic process
GO:0006644	0.938	phospholipid metabolic process
GO:0046486	0.906	glycerolipid metabolic process
GO:0046434	0.855	organophosphate catabolic process
GO:0006650	0.850	glycerophospholipid metabolic process
GO:0016042	0.832	lipid catabolic process
GO:0044248	0.762	cellular catabolic process
GO:0050789	0.417	regulation of biological process
GO:0050794	0.387	regulation of cellular process
GO:0046503	0.358	glycerolipid catabolic process
GO:0046475	0.350	glycerophospholipid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005886	0.999	plasma membrane
GO:0005576	0.966	extracellular region
GO:0005622	0.919	intracellular anatomical structure
GO:0005737	0.812	cytoplasm
GO:0005615	0.802	extracellular space
GO:0031982	0.779	vesicle
GO:0012505	0.726	endomembrane system
GO:0070062	0.591	extracellular exosome
GO:0043231	0.575	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	0.999	Phosphoric diester hydrolases.

[back to server]