StarFunc result for job id Q6UWU4

User Input

>input (347 residues)
MDLAANEISIYDKLSETVDLVRQTGHQCGMSEKAIEKFIRQLLEKNEPQRPPPQYPLLIV
VYKVLATLGLILLTAYFVIQPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKKYMSENK
GVPLHGGDEDRPFPDFDPWWTNDCEQNESEPIPANCTGCAQKHLKVMLLEDAPRKFERLH
PLVIKTGKPLLEEEIQHFLCQYPEATEGFSEGFFAKWWRCFPERWFPFPYPWRRPLNRSQ
MLRELFPVFTHLPFPKDASLNKCSFLHPEPVVGSKMHKMPDLFIIGSGEAMLQLIPPFQC
RRHCQSVAMPIEPGDIGYVDTTHWKVYVIARGVQPLVICDGTAFSEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UWU4	1.000	1.000	1.629E-68	347	1.000	1.000	Q6UWU4.pdb.gz	CF089_HUMAN Bombesin receptor-activated protein C6orf89 OS=Homo sapiens OX=9606 GN=C6orf89 PE=1 SV=1
2	PDB:4qszA	0.281	0.162	2.083E-4	686	0.098	0.050	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
3	PDB:5nfnB	0.263	0.282	3.769E-4	318	0.098	0.107	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
4	PDB:7yxgA	0.248	0.269	5.071E-4	313	0.110	0.121	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
5	PDB:3al5B	0.231	0.251	7.680E-4	311	0.101	0.113	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
6	PDB:4b7eA	0.146	0.145	8.648E-4	349	0.049	0.049	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
7	PDB:2ixhA	0.199	0.345	1.163E-3	184	0.032	0.060	2ixhA.pdb.gz	RmlC, a C3' and C5' carbohydrate epimerase, appears to operate via an intermediate with an unusual twist boat conformation.
8	PDB:1dztA	0.160	0.284	2.370E-3	183	0.032	0.060	1dztA.pdb.gz	Rmlc, the Third Enzyme of Dtdp-L-Rhamnose Pathway, is a New Class of Epimerase.
9	AFDB:P0DO15	0.157	0.094	2.699E-3	605	0.161	0.093	P0DO15.pdb.gz	GLCA2_SOYBN Beta-conglycinin alpha subunit 2 OS=Glycine max OX=3847 GN=CG-2 PE=1 SV=1
10	PDB:1j3pA	0.207	0.366	3.188E-3	187	0.046	0.086	1j3pA.pdb.gz	Characterization of the cupin-type phosphoglucose isomerase from the hyperthermophilic archaeon Thermococcus litoralis(1).
11	PDB:4qkbA	0.224	0.351	3.590E-3	190	0.078	0.142	4qkbA.pdb.gz	The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism
12	AFDB:Q7K4H4	0.283	0.165	4.602E-3	653	0.107	0.057	Q7K4H4.pdb.gz	NO66_DROME Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 OS=Drosophila melanogaster OX=7227 GN=NO66 PE=1 SV=1
13	PDB:3al5C	0.234	0.271	5.770E-3	284	0.095	0.116	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
14	AFDB:P27434	0.110	0.112	1.056E-2	337	0.089	0.092	P27434.pdb.gz	RODZ_ECOLI Cytoskeleton protein RodZ OS=Escherichia coli (strain K12) OX=83333 GN=rodZ PE=1 SV=2
15	AFDB:Q9VU86	0.123	0.039	1.067E-1	1873	0.089	0.017	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
16	AFDB:Q9VQG9	0.119	0.088	1.353E-1	586	0.104	0.061	Q9VQG9.pdb.gz	Q9VQG9_DROME Dawdle, isoform A OS=Drosophila melanogaster OX=7227 GN=daw PE=2 SV=1
17	AFDB:O15054	0.169	0.041	4.429E-1	1643	0.043	0.009	O15054.pdb.gz	KDM6B_HUMAN Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4
18	AFDB:Q9FJS2	0.117	0.067	4.987E-1	826	0.133	0.056	Q9FJS2.pdb.gz	HDG5_ARATH Homeobox-leucine zipper protein HDG5 OS=Arabidopsis thaliana OX=3702 GN=HDG5 PE=2 SV=3
19	AFDB:Q9FX31	0.117	0.066	5.958E-1	722	0.118	0.057	Q9FX31.pdb.gz	HDG11_ARATH Homeobox-leucine zipper protein HDG11 OS=Arabidopsis thaliana OX=3702 GN=HDG11 PE=1 SV=1
20	AFDB:Q94C37	0.106	0.063	6.322E-1	721	0.130	0.062	Q94C37.pdb.gz	HDG2_ARATH Homeobox-leucine zipper protein HDG2 OS=Arabidopsis thaliana OX=3702 GN=HDG2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UWU4	0.0	718	347	1.000	1.000	CF089_HUMAN Bombesin receptor-activated protein C6orf89 OS=Homo sapiens OX=9606 GN=C6orf89 PE=1 SV=1
2	Q9C8G9	0.61	34.7	1622	0.084	0.018	AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCC1 PE=1 SV=1
3	Q9VQ57	1.0	33.1	245	0.040	0.057	DERL1_DROME Derlin-1 OS=Drosophila melanogaster OX=7227 GN=Der-1 PE=2 SV=1
4	F1QW63	1.3	33.5	581	0.063	0.038	F1QW63_DANRE Alpha-(1,6)-fucosyltransferase OS=Danio rerio OX=7955 GN=fut8a PE=3 SV=1
5	Q9BYC5	1.3	33.5	575	0.089	0.054	FUT8_HUMAN Alpha-(1,6)-fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT8 PE=1 SV=2
6	Q9WTS2	1.5	33.1	575	0.081	0.049	FUT8_MOUSE Alpha-(1,6)-fucosyltransferase OS=Mus musculus OX=10090 GN=Fut8 PE=1 SV=2
7	Q9SU29	1.6	33.1	873	0.052	0.021	UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana OX=3702 GN=UPL5 PE=1 SV=1
8	Q8VZJ2	1.8	32.7	344	0.061	0.061	BGNEM_ARATH Probable glucan endo-1,3-beta-glucosidase At4g16260 OS=Arabidopsis thaliana OX=3702 GN=At4g16260 PE=1 SV=1
9	A2AN08	2.5	32.7	5180	0.086	0.006	UBR4_MOUSE E3 ubiquitin-protein ligase UBR4 OS=Mus musculus OX=10090 GN=Ubr4 PE=1 SV=1
10	Q5T4S7	2.7	32.7	5183	0.084	0.006	UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1
11	P79282	3.2	32.3	575	0.084	0.050	FUT8_PIG Alpha-(1,6)-fucosyltransferase OS=Sus scrofa OX=9823 GN=FUT8 PE=1 SV=1
12	A7SNT7	6.0	30.8	198	0.066	0.116	A7SNT7_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g246444 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359682	0.896	Bombesin receptor subtype-3
2	9606.ENSP00000482732	0.590	Tyrosine-protein phosphatase non-receptor type 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0048522	0.956	positive regulation of cellular process
GO:0080090	0.953	regulation of primary metabolic process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0050896	0.866	response to stimulus
GO:0009893	0.864	positive regulation of metabolic process
GO:0051173	0.853	positive regulation of nitrogen compound metabolic process
GO:0010604	0.849	positive regulation of macromolecule metabolic process
GO:0050790	0.775	regulation of catalytic activity
GO:0090311	0.747	regulation of protein deacetylation
GO:0031056	0.747	regulation of histone modification
GO:0050673	0.741	epithelial cell proliferation
GO:0006950	0.727	response to stress
GO:0009611	0.709	response to wounding
GO:0051726	0.700	regulation of cell cycle
GO:0051247	0.686	positive regulation of protein metabolic process
GO:0044093	0.659	positive regulation of molecular function
GO:0045787	0.651	positive regulation of cell cycle
GO:0031063	0.640	regulation of histone deacetylation
GO:0042060	0.637	wound healing
GO:0031058	0.603	positive regulation of histone modification
GO:0043085	0.554	positive regulation of catalytic activity
GO:0051336	0.477	regulation of hydrolase activity
GO:0008152	0.412	metabolic process
GO:0071704	0.399	organic substance metabolic process
GO:0044238	0.347	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030496	0.998	midbody
GO:0000139	0.998	Golgi membrane
GO:0005730	0.998	nucleolus
GO:0005654	0.519	nucleoplasm
GO:0005783	0.381	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]