StarFunc result for job id Q6UWV6

User Input

>input (458 residues)
MRGLAVLLTVALATLLAPGAGAPVQSQGSQNKLLLVSFDGFRWNYDQDVDTPNLDAMARD
GVKARYMTPAFVTMTSPCHFTLVTGKYIENHGVVHNMYYNTTSKVKLPYHATLGIQRWWD
NGSVPIWITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANIDTVM
AWFTEEDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLN
LIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDAL
KDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNNGEHGFDNKDM
DMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPEANDGHLATLLPMLHTESALP
PDGRPTLLPKGRSALPPSSRPLLVMGLLGTVILLSEVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UWV6	1.000	1.000	1.077E-101	458	1.000	1.000	Q6UWV6.pdb.gz	ENPP7_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Homo sapiens OX=9606 GN=ENPP7 PE=1 SV=4
2	AFDB:Q3TIW9	0.858	0.895	9.171E-84	439	0.751	0.784	Q3TIW9.pdb.gz	ENPP7_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Mus musculus OX=10090 GN=Enpp7 PE=1 SV=1
3	AFDB:P84039	0.802	0.770	1.151E-47	477	0.330	0.317	P84039.pdb.gz	ENPP5_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Rattus norvegicus OX=10116 GN=Enpp5 PE=1 SV=2
4	AFDB:Q9UJA9	0.799	0.768	7.621E-47	477	0.317	0.304	Q9UJA9.pdb.gz	ENPP5_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Homo sapiens OX=9606 GN=ENPP5 PE=1 SV=1
5	PDB:5venA	0.776	0.926	3.754E-46	382	0.306	0.366	5venA.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
6	AFDB:Q6UWR7	0.817	0.850	2.052E-45	440	0.290	0.302	Q6UWR7.pdb.gz	ENPP6_HUMAN Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Homo sapiens OX=9606 GN=ENPP6 PE=1 SV=2
7	PDB:5vemB	0.775	0.922	4.304E-45	383	0.301	0.360	5vemB.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
8	AFDB:Q8BGN3	0.803	0.835	1.760E-43	440	0.269	0.280	Q8BGN3.pdb.gz	ENPP6_MOUSE Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Mus musculus OX=10090 GN=Enpp6 PE=1 SV=1
9	AFDB:Q9Y6X5	0.769	0.778	4.739E-42	453	0.288	0.291	Q9Y6X5.pdb.gz	ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3
10	PDB:6wevAbA	0.761	0.436	9.334E-38	817	0.264	0.148	6wevAbA.pdb.gz	Crystal structures of human ENPP1 in apo and bound forms.
11	AFDB:Q9SU81	0.749	0.744	1.602E-37	461	0.264	0.262	Q9SU81.pdb.gz	Q9SU81_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29700 PE=1 SV=1
12	PDB:4b56A	0.742	0.427	5.472E-37	816	0.264	0.148	4b56A.pdb.gz	Structure of Npp1, an Ectonucleotide Pyrophosphatase/Phosphodiesterase Involved in Tissue Calcification.
13	PDB:6c01A	0.750	0.428	8.385E-37	819	0.258	0.144	6c01A.pdb.gz	Structural basis for nucleotide recognition by the ectoenzyme CD203c.
14	AFDB:P06802	0.756	0.391	1.836E-36	906	0.266	0.135	P06802.pdb.gz	ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus OX=10090 GN=Enpp1 PE=1 SV=4
15	AFDB:P97675	0.746	0.399	3.179E-36	875	0.258	0.135	P97675.pdb.gz	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
16	PDB:6xkdB	0.754	0.515	1.022E-35	681	0.266	0.179	6xkdB.pdb.gz	Structure-Aided Development of Small-Molecule Inhibitors of ENPP1, the Extracellular Phosphodiesterase of the Immunotransmitter cGAMP.
17	PDB:3wayA	0.703	0.419	1.052E-33	787	0.275	0.160	3wayA.pdb.gz	Screening and X-ray Crystal Structure-based Optimization of Autotaxin (ENPP2) Inhibitors, Using a Newly Developed Fluorescence Probe
18	PDB:5s9mA	0.706	0.409	5.461E-33	809	0.273	0.155	5s9mA.pdb.gz	Crystal Structure of a rat Autotaxin complex
19	PDB:6g4gC	0.656	0.414	6.643E-28	742	0.227	0.140	6g4gC.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
20	PDB:6g4gD	0.654	0.394	1.018E-27	781	0.234	0.137	6g4gD.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TIW9	0.0	733	439	0.771	0.804	ENPP7_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Mus musculus OX=10090 GN=Enpp7 PE=1 SV=1
2	Q5EZ72	0.0	749	439	0.779	0.813	ENPP7_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Rattus norvegicus OX=10116 GN=Enpp7 PE=1 SV=1
3	Q6UWV6	0.0	946	458	0.998	0.998	ENPP7_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Homo sapiens OX=9606 GN=ENPP7 PE=1 SV=4
4	P84039	6.80e-84	268	477	0.354	0.340	ENPP5_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Rattus norvegicus OX=10116 GN=Enpp5 PE=1 SV=2
5	Q9EQG7	3.07e-83	266	477	0.332	0.319	ENPP5_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Mus musculus OX=10090 GN=Enpp5 PE=1 SV=3
6	Q9UJA9	4.63e-80	258	477	0.338	0.325	ENPP5_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Homo sapiens OX=9606 GN=ENPP5 PE=1 SV=1
7	Q9Y6X5	2.44e-64	216	453	0.312	0.316	ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3
8	Q6UWR7	1.95e-62	211	440	0.288	0.300	ENPP6_HUMAN Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Homo sapiens OX=9606 GN=ENPP6 PE=1 SV=2
9	Q9SU81	9.66e-58	199	461	0.290	0.289	Q9SU81_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29700 PE=1 SV=1
10	Q8BGN3	7.61e-57	196	440	0.282	0.293	ENPP6_MOUSE Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Mus musculus OX=10090 GN=Enpp6 PE=1 SV=1
11	P97675	1.02e-51	189	875	0.290	0.152	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
12	Q9SU83	2.69e-51	182	496	0.255	0.236	Q9SU83_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29680 PE=1 SV=1
13	O14638	7.22e-51	187	875	0.279	0.146	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
14	Q6DYE8	1.18e-50	186	874	0.282	0.148	ENPP3_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Mus musculus OX=10090 GN=Enpp3 PE=1 SV=2
15	P22413	2.05e-50	186	925	0.269	0.133	ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2
16	B2RBY8	3.04e-50	185	873	0.269	0.141	B2RBY8_HUMAN cDNA, FLJ95771, highly similar to Homo sapiens ectonucleotide pyrophosphatase/phosphodiesterase 1 (ENPP1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
17	Q924C3	6.01e-50	184	906	0.277	0.140	ENPP1_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Rattus norvegicus OX=10116 GN=Enpp1 PE=1 SV=2
18	P06802	1.08e-49	183	906	0.266	0.135	ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus OX=10090 GN=Enpp1 PE=1 SV=4
19	Q9R1E6	1.84e-49	182	862	0.295	0.157	ENPP2_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Mus musculus OX=10090 GN=Enpp2 PE=1 SV=3
20	B0JZL7	1.25e-48	180	878	0.282	0.147	B0JZL7_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Danio rerio OX=7955 GN=si:ch211-142e24.2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01676 Metalloenzyme	0.064	24.2	Metalloenzyme superfamily
2	PF01663 Phosphodiest	2.1e-74	262.9	Type I phosphodiesterase / nucleotide pyrophosphatase
3	PF00884 Sulfatase	0.00033	31.8	Sulfatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332656

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216264	0.950	Ceramide kinase
2	9606.ENSP00000258052	0.939	Sphingomyelin phosphodiesterase 2
3	9606.ENSP00000363397	0.936	Ceramide glucosyltransferase
4	9606.ENSP00000340409	0.933	Sphingomyelin phosphodiesterase
5	9606.ENSP00000311648	0.911	2-hydroxyacylsphingosine 1-beta-galactosyltransferase
6	9606.ENSP00000386531	0.907	Sphingomyelin phosphodiesterase 4
7	9606.ENSP00000219334	0.903	Sphingomyelin phosphodiesterase 3
8	9606.ENSP00000261304	0.900	Galactocerebrosidase
9	9606.ENSP00000378897	0.892	Neutral ceramidase
10	9606.ENSP00000354829	0.854	Phosphatidylcholine:ceramide cholinephosphotransferase 1
11	9606.ENSP00000378176	0.833	Phosphatidylcholine:ceramide cholinephosphotransferase 2
12	9606.ENSP00000376453	0.810	Ceramide synthase 6
13	9606.ENSP00000371152	0.805	Acid ceramidase
14	9606.ENSP00000251363	0.782	Ceramide synthase 4
15	9606.ENSP00000301452	0.774	Alkaline ceramidase 1
16	9606.ENSP00000342609	0.769	Alkaline ceramidase 2
17	9606.ENSP00000325485	0.753	Ceramide synthase 5
18	9606.ENSP00000271688	0.746	Ceramide synthase 2
19	9606.ENSP00000247225	0.744	Sphingosine-1-phosphate phosphatase 1
20	9606.ENSP00000307126	0.731	Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008270	0.999	zinc ion binding
GO:0004767	0.999	sphingomyelin phosphodiesterase activity
GO:0005515	0.995	protein binding
GO:0016740	0.371	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.990	cellular metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0050789	0.970	regulation of biological process
GO:0006807	0.969	nitrogen compound metabolic process
GO:0006643	0.956	membrane lipid metabolic process
GO:1901564	0.950	organonitrogen compound metabolic process
GO:0050794	0.944	regulation of cellular process
GO:0006644	0.930	phospholipid metabolic process
GO:0006665	0.889	sphingolipid metabolic process
GO:0019222	0.879	regulation of metabolic process
GO:0031323	0.866	regulation of cellular metabolic process
GO:0043603	0.853	amide metabolic process
GO:0080090	0.846	regulation of primary metabolic process
GO:0060255	0.846	regulation of macromolecule metabolic process
GO:0051171	0.840	regulation of nitrogen compound metabolic process
GO:1901135	0.602	carbohydrate derivative metabolic process
GO:0019219	0.427	regulation of nucleobase-containing compound metabolic process
GO:0046467	0.417	membrane lipid biosynthetic process
GO:0051052	0.388	regulation of DNA metabolic process
GO:1903509	0.378	liposaccharide metabolic process
GO:0006664	0.369	glycolipid metabolic process
GO:0006687	0.335	glycosphingolipid metabolic process
GO:0006672	0.330	ceramide metabolic process
GO:0030148	0.323	sphingolipid biosynthetic process
GO:0048519	0.319	negative regulation of biological process
GO:0048523	0.308	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0031090	0.898	organelle membrane
GO:0005794	0.778	Golgi apparatus
GO:0042995	0.415	cell projection
GO:0005576	0.344	extracellular region
GO:0120025	0.337	plasma membrane bounded cell projection
GO:0031982	0.331	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19253	0.999	a sphingomyelin + H2O = an N-acylsphing-4-enine + H(+) + phosphocholine
EC:3.1.4.12	0.999	sphingomyelin phosphodiesterase.
EC:2.-.-.-	0.371	Transferases.

[back to server]