StarFunc result for job id Q6UX27

User Input

>input (236 residues)
MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVL
RKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDK
HDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHSSSSEESTKRTSHSKLPE
QEAAEADLSNMERVSLSTADPQGVTYAELSTSALSEAASDTTQEPPGSHEYAALKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UX27	1.000	1.000	1.208E-39	236	1.000	1.000	Q6UX27.pdb.gz	VSTM1_HUMAN V-set and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSTM1 PE=1 SV=2
2	AFDB:Q64281	0.424	0.310	2.146E-12	335	0.220	0.155	Q64281.pdb.gz	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
3	AFDB:B6A8R8	0.381	0.315	3.390E-12	288	0.203	0.167	B6A8R8.pdb.gz	TARM1_MOUSE T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Mus musculus OX=10090 GN=Tarm1 PE=2 SV=1
4	AFDB:P97484	0.384	0.116	3.390E-12	841	0.242	0.068	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
5	AFDB:B6A8C7	0.380	0.332	4.024E-12	271	0.246	0.214	B6A8C7.pdb.gz	TARM1_HUMAN T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Homo sapiens OX=9606 GN=TARM1 PE=1 SV=2
6	AFDB:Q8NHJ6	0.363	0.196	1.883E-11	448	0.237	0.125	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
7	AFDB:O75022	0.382	0.153	2.809E-11	631	0.242	0.090	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
8	AFDB:Q8N423	0.380	0.155	3.738E-11	598	0.254	0.100	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
9	AFDB:Q925N6	0.388	0.072	4.697E-11	1320	0.186	0.033	Q925N6.pdb.gz	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1
10	AFDB:Q61450	0.412	0.334	1.172E-10	303	0.174	0.135	Q61450.pdb.gz	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
11	PDB:8e4cC	0.264	0.407	2.061E-5	142	0.102	0.169	8e4cC.pdb.gz
12	PDB:5hhmI	0.323	0.381	2.590E-5	196	0.072	0.087	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
13	PDB:6sm1A	0.274	0.524	4.857E-5	111	0.076	0.162	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
14	PDB:5ir3A	0.280	0.534	6.104E-5	111	0.068	0.144	5ir3A.pdb.gz
15	PDB:1ohqA	0.259	0.456	8.601E-5	120	0.068	0.133	1ohqA.pdb.gz
16	PDB:1ezvX	0.308	0.525	9.107E-5	127	0.051	0.094	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
17	PDB:3zhlA	0.302	0.535	1.021E-4	121	0.059	0.116	3zhlA.pdb.gz
18	PDB:1cd0A	0.278	0.530	1.359E-4	111	0.072	0.153	1cd0A.pdb.gz
19	PDB:4m62L	0.265	0.472	1.359E-4	113	0.072	0.150	4m62L.pdb.gz
20	PDB:2q20B	0.244	0.453	1.438E-4	109	0.072	0.156	2q20B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UX27	3.17e-176	485	236	1.000	1.000	VSTM1_HUMAN V-set and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSTM1 PE=1 SV=2
2	B6A8C7	4.45e-25	101	271	0.267	0.232	TARM1_HUMAN T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Homo sapiens OX=9606 GN=TARM1 PE=1 SV=2
3	B6A8R8	7.20e-14	71.2	288	0.195	0.160	TARM1_MOUSE T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Mus musculus OX=10090 GN=Tarm1 PE=2 SV=1
4	Q28109	5.66e-13	68.6	264	0.186	0.167	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
5	Q9HCN6	1.05e-12	68.6	339	0.186	0.130	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
6	Q8NHJ6	3.44e-12	67.4	448	0.178	0.094	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
7	O75022	4.50e-12	67.4	631	0.182	0.068	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
8	Q8N149	1.03e-11	66.2	483	0.195	0.095	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
9	Q8NHL6	2.65e-11	65.1	650	0.178	0.065	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
10	Q925N6	4.09e-11	64.7	1320	0.153	0.027	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1
11	O76036	8.22e-11	62.8	304	0.169	0.132	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
12	Q8N6C5	1.59e-10	62.8	1336	0.148	0.026	IGSF1_HUMAN Immunoglobulin superfamily member 1 OS=Homo sapiens OX=9606 GN=IGSF1 PE=1 SV=3
13	Q6GTX8	1.64e-10	62.0	287	0.174	0.143	LAIR1_HUMAN Leukocyte-associated immunoglobulin-like receptor 1 OS=Homo sapiens OX=9606 GN=LAIR1 PE=1 SV=2
14	A6NI73	3.39e-10	60.8	299	0.169	0.134	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
15	Q6ISS4	4.41e-10	58.5	152	0.165	0.257	LAIR2_HUMAN Leukocyte-associated immunoglobulin-like receptor 2 OS=Homo sapiens OX=9606 GN=LAIR2 PE=1 SV=1
16	O75023	4.92e-10	61.2	590	0.186	0.075	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
17	Q8N6C8	1.23e-09	59.7	439	0.174	0.093	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
18	Q8N423	2.39e-09	59.3	597	0.174	0.069	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
19	D3YTC8	3.56e-09	57.8	286	0.174	0.143	D3YTC8_HUMAN Leukocyte associated immunoglobulin like receptor 1 OS=Homo sapiens OX=9606 GN=LAIR1 PE=1 SV=2
20	Q8C567	3.57e-09	58.2	325	0.174	0.126	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12263 DUF3611	4.1e+02	12.3	Protein of unknown function (DUF3611)
2	PF16332 DUF4962	1.6	18.8	Domain of unknown function (DUF4962)
3	PF19904 DUF6377	38	15.3	Domain of unknown function (DUF6377)
4	PF14575 EphA2_TM	3.8e+02	13.2	Ephrin type-A receptor 2 transmembrane domain
5	PF19320 GlfT2_domain3	74	14.5	Galactofuranosyltransferase-2, domain 3
6	PF07679 I-set	3.8e+02	12.6	Immunoglobulin I-set domain
7	PF00047 ig	0.23	23.0	Immunoglobulin domain
8	PF13895 Ig_2	0.00018	33.0	Immunoglobulin domain
9	PF13927 Ig_3	0.00055	31.8	Immunoglobulin domain
10	PF06024 Orf78	2.2e+02	13.5	Orf78 (ac78)
11	PF15872 SRTM1	4.6e+02	12.4	Serine-rich and transmembrane domain-containing protein 1
12	PF11807 UstYa	28	16.0	Mycotoxin biosynthesis protein UstYa
13	PF07686 V-set	16	17.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343366

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479355	0.680	Leukocyte receptor cluster member 9
2	9606.ENSP00000384103	0.662	V-set and transmembrane domain-containing protein 2A
3	9606.ENSP00000365714	0.658	Protein tweety homolog 1
4	9606.ENSP00000318374	0.630	Leukocyte receptor cluster member 8
5	9606.ENSP00000347648	0.594	Zinc finger protein 512
6	9606.ENSP00000360129	0.582	EF-hand calcium-binding domain-containing protein 7
7	9606.ENSP00000295150	0.549	Protein FAM228A
8	9606.ENSP00000304437	0.540	Protein very KIND
9	9606.ENSP00000375639	0.504	TCF3 fusion partner

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002682	0.996	regulation of immune system process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0051239	0.984	regulation of multicellular organismal process
GO:0050896	0.963	response to stimulus
GO:0002694	0.935	regulation of leukocyte activation
GO:0048519	0.933	negative regulation of biological process
GO:0002683	0.873	negative regulation of immune system process
GO:0048523	0.806	negative regulation of cellular process
GO:0002698	0.789	negative regulation of immune effector process
GO:0002695	0.687	negative regulation of leukocyte activation
GO:0019222	0.669	regulation of metabolic process
GO:0051249	0.650	regulation of lymphocyte activation
GO:0002376	0.615	immune system process
GO:0051716	0.592	cellular response to stimulus
GO:0048583	0.565	regulation of response to stimulus
GO:0051250	0.555	negative regulation of lymphocyte activation
GO:0050863	0.506	regulation of T cell activation
GO:0032501	0.499	multicellular organismal process
GO:0048518	0.468	positive regulation of biological process
GO:0023052	0.348	signaling
GO:0007154	0.340	cell communication
GO:0060255	0.337	regulation of macromolecule metabolic process
GO:0007165	0.323	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005622	0.858	intracellular anatomical structure
GO:0009986	0.637	cell surface
GO:0005737	0.364	cytoplasm
GO:0043227	0.323	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]