StarFunc result for job id Q6UX39

User Input

>input (209 residues)
MRSTILLFCLLGSTRSLPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQML
TLGPDLHLLNPAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQGTILSSEELP
QIFTSLIIHSLFPGGILPTSQAGANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDD
DFAVTTPAGIQRSTHAIEEATTESANGIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UX39	1.000	1.000	6.081E-32	209	1.000	1.000	Q6UX39.pdb.gz	AMTN_HUMAN Amelotin OS=Homo sapiens OX=9606 GN=AMTN PE=1 SV=1
2	AFDB:Q9D3J8	0.169	0.167	3.430E-14	213	0.608	0.596	Q9D3J8.pdb.gz	AMTN_MOUSE Amelotin OS=Mus musculus OX=10090 GN=Amtn PE=2 SV=1
3	AFDB:Q3HS82	0.179	0.178	3.984E-13	212	0.603	0.594	Q3HS82.pdb.gz	AMTN_RAT Amelotin OS=Rattus norvegicus OX=10116 GN=Amtn PE=1 SV=1
4	AFDB:Q5A4X5	0.080	0.037	2.720E-1	559	0.196	0.073	Q5A4X5.pdb.gz	SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SKN7 PE=3 SV=1
5	AFDB:Q9VIV8	0.090	0.050	1.303	454	0.124	0.057	Q9VIV8.pdb.gz	Q9VIV8_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13084 PE=4 SV=1
6	AFDB:Q9BUG6	0.153	0.078	2.100	496	0.144	0.060	Q9BUG6.pdb.gz	ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ZSCAN5A PE=1 SV=1
7	AFDB:Q6ZW76	0.104	0.060	2.248	656	0.115	0.037	Q6ZW76.pdb.gz	ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ANKS3 PE=1 SV=1
8	AFDB:Q9VEF5	0.136	0.079	2.406	433	0.163	0.079	Q9VEF5.pdb.gz	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
9	AFDB:Q7XLY8	0.091	0.055	2.952	383	0.148	0.081	Q7XLY8.pdb.gz	ATL41_ORYSJ E3 ubiquitin-protein ligase Os04g0590900 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0590900 PE=2 SV=2
10	AFDB:Q9SSW2	0.115	0.098	2.952	273	0.144	0.110	Q9SSW2.pdb.gz	AZF2_ARATH Zinc finger protein AZF2 OS=Arabidopsis thaliana OX=3702 GN=AZF2 PE=2 SV=1
11	PDB:6t9iI	0.087	0.102	3.244	173	0.086	0.104	6t9iI.pdb.gz
12	PDB:6n8jb	0.098	0.042	7.866	647	0.086	0.028	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UX39	1.19e-144	403	209	1.000	1.000	AMTN_HUMAN Amelotin OS=Homo sapiens OX=9606 GN=AMTN PE=1 SV=1
2	Q3HS82	1.14e-62	195	212	0.603	0.594	AMTN_RAT Amelotin OS=Rattus norvegicus OX=10116 GN=Amtn PE=1 SV=1
3	Q9D3J8	1.14e-60	190	213	0.608	0.596	AMTN_MOUSE Amelotin OS=Mus musculus OX=10090 GN=Amtn PE=2 SV=1
4	A0A0A0MTC1	0.21	35.0	5256	0.163	0.006	A0A0A0MTC1_HUMAN Ring finger protein 213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=1
5	A0A0A0MTR7	0.21	35.0	5207	0.163	0.007	A0A0A0MTR7_HUMAN Ring finger protein 213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=1
6	Q63HN8	0.21	35.0	5207	0.163	0.007	RN213_HUMAN E3 ubiquitin-protein ligase RNF213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=3
7	Q98SN3	0.60	33.5	805	0.091	0.024	Q98SN3_CHICK Aryl hydrocarbon receptor nuclear translocator OS=Gallus gallus OX=9031 PE=2 SV=1
8	Q86VP1	5.5	30.4	789	0.081	0.022	TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2
9	Q58FA4	7.2	30.0	860	0.081	0.020	E2F8_MOUSE Transcription factor E2F8 OS=Mus musculus OX=10090 GN=E2f8 PE=1 SV=1
10	Q54GP8	8.3	28.5	100	0.091	0.190	GLRX_DICDI Glutaredoxin OS=Dictyostelium discoideum OX=44689 GN=grxA PE=2 SV=1
11	P0ABB8	9.9	29.6	898	0.124	0.029	ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) OX=83333 GN=mgtA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15757 Amelotin	7.4e-93	321.1	Amelotin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341013

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379401	0.948	Odontogenic ameloblast-associated protein
2	9606.ENSP00000379383	0.904	Enamelin
3	9606.ENSP00000313809	0.883	Ameloblastin
4	9606.ENSP00000370088	0.852	Amelogenin, X isoform
5	9606.ENSP00000326159	0.814	Kallikrein-4
6	9606.ENSP00000260228	0.792	Matrix metalloproteinase-20
7	9606.ENSP00000406925	0.681	Odontogenesis associated phosphoprotein
8	9606.ENSP00000382213	0.680	Dentin sialophosphoprotein
9	9606.ENSP00000379619	0.677	WD repeat-containing protein 72
10	9606.ENSP00000322323	0.675	Extracellular serine/threonine protein kinase FAM20C
11	9606.ENSP00000270593	0.671	Testicular acid phosphatase
12	9606.ENSP00000254801	0.667	Immunoglobulin J chain
13	9606.ENSP00000226444	0.656	Estrogen sulfotransferase
14	9606.ENSP00000373565	0.654	Protein FAM83H
15	9606.ENSP00000468308	0.646	Pseudokinase FAM20A
16	9606.ENSP00000357842	0.628	Tuftelin
17	9606.ENSP00000431840	0.605	Sodium/potassium/calcium exchanger 4
18	9606.ENSP00000337816	0.602	Matrix metalloproteinase-25
19	9606.ENSP00000414856	0.581	SPARC-like protein 1
20	9606.ENSP00000375778	0.567	Laminin subunit beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.961	regulation of biological process
GO:0048518	0.929	positive regulation of biological process
GO:0032502	0.739	developmental process
GO:0048856	0.733	anatomical structure development
GO:0042476	0.602	odontogenesis
GO:0070167	0.466	regulation of biomineral tissue development
GO:0070169	0.419	positive regulation of biomineral tissue development
GO:0042475	0.373	odontogenesis of dentin-containing tooth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0070013	0.994	intracellular organelle lumen
GO:0012505	0.993	endomembrane system
GO:0005783	0.981	endoplasmic reticulum
GO:0005788	0.960	endoplasmic reticulum lumen
GO:0071944	0.873	cell periphery
GO:0005576	0.740	extracellular region
GO:0031012	0.714	extracellular matrix
GO:0031981	0.319	nuclear lumen
GO:0005654	0.309	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]