StarFunc result for job id Q6UX46

User Input

>input (152 residues)
MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQ
LLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYH
NTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UX46	1.000	1.000	3.183E-25	152	1.000	1.000	Q6UX46.pdb.gz	ALKL2_HUMAN ALK and LTK ligand 2 OS=Homo sapiens OX=9606 GN=ALKAL2 PE=1 SV=2
2	AFDB:E7FAP8	0.424	0.333	6.547E-11	195	0.487	0.379	E7FAP8.pdb.gz	AKL2B_DANRE ALK and LTK ligand 2b OS=Danio rerio OX=7955 GN=alkal2b PE=2 SV=1
3	AFDB:Q6UXT8	0.399	0.468	4.656E-10	129	0.454	0.535	Q6UXT8.pdb.gz	ALKL1_HUMAN ALK and LTK ligand 1 OS=Homo sapiens OX=9606 GN=ALKAL1 PE=1 SV=1
4	AFDB:F1R8V3	0.435	0.390	7.257E-9	170	0.428	0.382	F1R8V3.pdb.gz
5	PDB:7n00B	0.360	0.927	5.780E-7	57	0.368	0.982	7n00B.pdb.gz
6	PDB:7mk7A	0.255	0.108	2.565E-5	369	0.237	0.098	7mk7A.pdb.gz	Structural basis for ligand reception by anaplastic lymphoma kinase.
7	AFDB:A0A0B4KI27	0.145	0.118	6.083E-1	245	0.164	0.102	A0A0B4KI27.pdb.gz	A0A0B4KI27_DROME Ferritin OS=Drosophila melanogaster OX=7227 GN=Fer1HCH PE=1 SV=1
8	AFDB:Q4GYD6	0.232	0.044	1.026	945	0.138	0.022	Q4GYD6.pdb.gz	Q4GYD6_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4420 PE=4 SV=1
9	AFDB:A0A1S3X835	0.206	0.112	1.096	337	0.112	0.050	A0A1S3X835.pdb.gz	MBP2C_TOBAC Protein MICROTUBULE BINDING PROTEIN 2C OS=Nicotiana tabacum OX=4097 GN=MBP2C PE=1 SV=1
10	PDB:7c79B	0.132	0.036	1.418	793	0.112	0.021	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
11	PDB:3jb9e	0.122	0.127	1.514	144	0.092	0.097	3jb9e.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
12	AFDB:Q653S9	0.172	0.047	1.732	714	0.191	0.041	Q653S9.pdb.gz	NCPR3_ORYSJ NADPH--cytochrome P450 reductase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR3 PE=1 SV=1
13	AFDB:Q62949	0.211	0.282	2.107	112	0.099	0.134	Q62949.pdb.gz	CORT_RAT Cortistatin OS=Rattus norvegicus OX=10116 GN=Cort PE=2 SV=1
14	AFDB:Q9SY60	0.132	0.043	2.107	769	0.178	0.035	Q9SY60.pdb.gz	EX84C_ARATH Exocyst complex component EXO84C OS=Arabidopsis thaliana OX=3702 GN=EXO84C PE=2 SV=1
15	PDB:5xjt2	0.123	0.091	3.109	217	0.092	0.065	5xjt2.pdb.gz	Structures of 7S mutant complexes
16	PDB:6zheC	0.139	0.039	3.109	705	0.138	0.030	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
17	PDB:6nmiC	0.123	0.060	3.543	408	0.191	0.071	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
18	PDB:5lj3G	0.147	0.216	4.038	97	0.053	0.082	5lj3G.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
19	PDB:7d5tRQ	0.163	0.092	4.311	339	0.145	0.065	7d5tRQ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state F1)
20	PDB:7rro2	0.137	0.084	4.311	292	0.112	0.058	7rro2.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UX46	1.63e-107	304	152	1.000	1.000	ALKL2_HUMAN ALK and LTK ligand 2 OS=Homo sapiens OX=9606 GN=ALKAL2 PE=1 SV=2
2	E7FAP8	6.52e-36	124	195	0.441	0.344	AKL2B_DANRE ALK and LTK ligand 2b OS=Danio rerio OX=7955 GN=alkal2b PE=2 SV=1
3	Q6UXT8	3.40e-35	120	129	0.355	0.419	ALKL1_HUMAN ALK and LTK ligand 1 OS=Homo sapiens OX=9606 GN=ALKAL1 PE=1 SV=1
4	F8W2C9	7.70e-32	112	152	0.362	0.362	ALKL1_DANRE ALK and LTK ligand 1 OS=Danio rerio OX=7955 GN=alkal1 PE=2 SV=1
5	E7F5F0	3.40e-24	94.0	169	0.428	0.385	AKL2A_DANRE ALK and LTK ligand 2a OS=Danio rerio OX=7955 GN=alkal2a PE=2 SV=3
6	Q99N50	0.30	33.1	950	0.125	0.020	SYTL2_MOUSE Synaptotagmin-like protein 2 OS=Mus musculus OX=10090 GN=Sytl2 PE=1 SV=2
7	Q9HCH5	0.46	32.7	934	0.118	0.019	SYTL2_HUMAN Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2 PE=1 SV=3
8	Q9Z1W7	2.4	30.4	417	0.138	0.050	Q9Z1W7_CRIGR Serpin H1 OS=Cricetulus griseus OX=10029 GN=Serpinh1 PE=2 SV=1
9	Q97NF1	2.8	30.0	338	0.112	0.050	GPDA_STRPN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gpsA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15129 FAM150	6.1e-48	173.6	FAM150 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384604

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373700	0.974	ALK tyrosine kinase receptor
2	9606.ENSP00000263800	0.799	Leukocyte tyrosine kinase receptor
3	9606.ENSP00000377374	0.721	Endoplasmic reticulum-Golgi intermediate compartment protein 1
4	9606.ENSP00000379696	0.708	cAMP-dependent protein kinase inhibitor alpha
5	9606.ENSP00000361057	0.707	Surfeit locus protein 4
6	9606.ENSP00000303366	0.704	Vesicular integral-membrane protein VIP36
7	9606.ENSP00000348471	0.702	SH3 domain-containing YSC84-like protein 1
8	9606.ENSP00000260128	0.674	Extracellular sulfatase Sulf-1
9	9606.ENSP00000307134	0.672	Catenin delta-2
10	9606.ENSP00000443926	0.665	CUGBP Elav-like family member 2
11	9606.ENSP00000356000	0.662	Plexin-A2
12	9606.ENSP00000328347	0.650	Protein FAM110C
13	9606.ENSP00000355995	0.649	Corticosteroid 11-beta-dehydrogenase isozyme 1
14	9606.ENSP00000356331	0.636	Nuclear receptor subfamily 5 group A member 2
15	9606.ENSP00000321711	0.622	DIS3-like exonuclease 1
16	9606.ENSP00000357494	0.552	Proto-oncogene tyrosine-protein kinase ROS

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030971	1.000	receptor tyrosine kinase binding
GO:0005125	1.000	cytokine activity
GO:0030298	1.000	receptor signaling protein tyrosine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0048522	0.963	positive regulation of cellular process
GO:0048583	0.946	regulation of response to stimulus
GO:0070372	0.939	regulation of ERK1 and ERK2 cascade
GO:0043410	0.938	positive regulation of MAPK cascade
GO:0120035	0.926	regulation of plasma membrane bounded cell projection organization
GO:0070374	0.904	positive regulation of ERK1 and ERK2 cascade
GO:0010975	0.873	regulation of neuron projection development
GO:0051130	0.805	positive regulation of cellular component organization
GO:0010976	0.664	positive regulation of neuron projection development
GO:0009987	0.621	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0016020	0.898	membrane
GO:0005622	0.819	intracellular anatomical structure
GO:0005737	0.756	cytoplasm
GO:0071944	0.581	cell periphery
GO:0043231	0.400	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]