StarFunc result for job id Q6UX52

User Input

>input (265 residues)
MGLPGLFCLAVLAASSFSKAREEEITPVVSIAYKVLEVFPKGRWVLITCCAPQPPPPITY
SLCGTKNIKVAKKVVKTHEPASFNLNVTLKSSPDLLTYFCWASSTSGAHVDSARLQMHWE
LWSKPVSELRANFTLQDRGAGPRVEMICQASSGSPPITNSLIGKDGQVHLQQRPCHRQPA
NFSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTR
RLSEEEFGGFRIGNGEVRGRKAAAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UX52	1.000	1.000	1.141E-44	265	1.000	1.000	Q6UX52.pdb.gz	IL40_HUMAN Protein IL-40 OS=Homo sapiens OX=9606 GN=C17orf99 PE=1 SV=2
2	AFDB:Q9CX63	0.488	0.509	1.630E-20	252	0.434	0.456	Q9CX63.pdb.gz	IL40_MOUSE Protein IL-40 OS=Mus musculus OX=10090 PE=2 SV=1
3	AFDB:Q7Z6M3	0.349	0.283	5.519E-10	343	0.196	0.152	Q7Z6M3.pdb.gz	MILR1_HUMAN Allergin-1 OS=Homo sapiens OX=9606 GN=MILR1 PE=1 SV=2
4	AFDB:Q96P31	0.323	0.139	4.322E-9	734	0.189	0.068	Q96P31.pdb.gz	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
5	AFDB:Q96LA5	0.347	0.197	4.350E-8	508	0.192	0.100	Q96LA5.pdb.gz	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
6	AFDB:Q96LA6	0.351	0.231	4.574E-8	429	0.177	0.110	Q96LA6.pdb.gz	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
7	AFDB:A1YIY0	0.345	0.341	1.961E-7	268	0.162	0.160	A1YIY0.pdb.gz	FCRL6_MOUSE Fc receptor-like protein 6 OS=Mus musculus OX=10090 GN=Fcrl6 PE=2 SV=2
8	AFDB:P16284	0.341	0.145	6.542E-7	738	0.211	0.076	P16284.pdb.gz	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2
9	AFDB:Q08481	0.342	0.147	6.542E-7	727	0.211	0.077	Q08481.pdb.gz	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1
10	AFDB:Q96PJ5	0.419	0.242	1.256E-6	515	0.177	0.091	Q96PJ5.pdb.gz	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
11	PDB:3besR	0.225	0.235	3.404E-4	250	0.091	0.096	3besR.pdb.gz
12	PDB:1a8jL	0.252	0.291	5.086E-4	216	0.117	0.144	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
13	PDB:1f13A	0.238	0.119	6.218E-4	722	0.091	0.033	1f13A.pdb.gz
14	PDB:5mhlA	0.270	0.138	6.874E-4	692	0.083	0.032	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.
15	PDB:1e07A	0.216	0.101	8.835E-4	642	0.147	0.061	1e07A.pdb.gz
16	PDB:3tygL	0.235	0.280	1.136E-3	207	0.087	0.111	3tygL.pdb.gz	A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
17	PDB:4lnvA	0.251	0.083	1.256E-3	1276	0.091	0.019	4lnvA.pdb.gz
18	PDB:1l9mB	0.249	0.134	1.320E-3	681	0.109	0.043	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
19	PDB:1lilA	0.237	0.287	1.388E-3	212	0.113	0.142	1lilA.pdb.gz
20	PDB:1q0xL	0.224	0.266	1.460E-3	212	0.091	0.113	1q0xL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UX52	0.0	550	265	1.000	1.000	IL40_HUMAN Protein IL-40 OS=Homo sapiens OX=9606 GN=C17orf99 PE=1 SV=2
2	Q9CX63	6.09e-71	220	252	0.415	0.437	IL40_MOUSE Protein IL-40 OS=Mus musculus OX=10090 PE=2 SV=1
3	P16284	0.22	35.4	738	0.166	0.060	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2
4	Q96RD9	0.49	34.3	977	0.166	0.045	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
5	A1YIY0	1.2	32.7	268	0.128	0.127	FCRL6_MOUSE Fc receptor-like protein 6 OS=Mus musculus OX=10090 GN=Fcrl6 PE=2 SV=2
6	P49364	1.3	32.7	408	0.128	0.083	GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum OX=3888 GN=GDCST PE=1 SV=2
7	Q05793	1.3	33.1	3707	0.177	0.013	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
8	Q3SWT0	1.3	32.7	678	0.170	0.066	PECA1_RAT Platelet endothelial cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Pecam1 PE=1 SV=1
9	Q6DN72	2.4	32.0	434	0.075	0.046	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
10	Q0E9I9	4.1	31.6	2031	0.109	0.014	Q0E9I9_DROME Down syndrome cell adhesion molecule 1, isoform X OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
11	Q99795	4.3	30.8	319	0.072	0.060	GPA33_HUMAN Cell surface A33 antigen OS=Homo sapiens OX=9606 GN=GPA33 PE=1 SV=1
12	Q0E9J0	4.4	31.2	2035	0.109	0.014	Q0E9J0_DROME Down syndrome cell adhesion molecule 1, isoform Y OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
13	Q0E9K4	4.4	31.2	2031	0.109	0.014	Q0E9K4_DROME Down syndrome cell adhesion molecule 1, isoform BE OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
14	Q0E9K9	4.4	31.2	2032	0.109	0.014	Q0E9K9_DROME Down syndrome cell adhesion molecule 1, isoform AO OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
15	A0A0B4K6R4	4.5	31.2	2035	0.109	0.014	A0A0B4K6R4_DROME Down syndrome cell adhesion molecule 1, isoform BK OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
16	Q0E9L6	4.5	31.2	2034	0.109	0.014	Q0E9L6_DROME Down syndrome cell adhesion molecule 1, isoform AV OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
17	A0A0B4K6R8	4.6	31.2	2019	0.109	0.014	A0A0B4K6R8_DROME Down syndrome cell adhesion molecule 1, isoform BP OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
18	A0A0B4K7T5	4.6	31.2	2033	0.109	0.014	A0A0B4K7T5_DROME Down syndrome cell adhesion molecule 1, isoform BJ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
19	A0A0C4DHD8	4.6	31.2	2016	0.109	0.014	A0A0C4DHD8_DROME Down syndrome cell adhesion molecule 1, isoform BS OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
20	Q0E9K7	4.6	31.2	2017	0.109	0.014	Q0E9K7_DROME Down syndrome cell adhesion molecule 1, isoform AM OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	15	17.2	Immunoglobulin domain
2	PF13927 Ig_3	3.8	19.5	Immunoglobulin domain
3	PF17736 Ig_C17orf99	4.5e-69	239.9	C17orf99 Ig domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9978.XP_004593090.1

Rank	PPI partner	STRING score	Description
1	9978.XP_004592926.1	0.745	Baculoviral IAP repeat-containing protein 5
2	9978.XP_004593091.1	0.697	Transmembrane channel-like protein 8
3	9978.XP_004598743.1	0.695	Helicase SKI2W
4	9978.XP_004578845.1	0.694	Nuclear receptor subfamily 5 group A member 2 isoform X1
5	9978.XP_004581643.1	0.648	Upstream in-frame stop codon
6	9978.XP_004578199.1	0.563	Upstream in-frame stop codon
7	9978.XP_004592925.1	0.543	Suppressor of cytokine signaling 3
8	9978.XP_004587986.1	0.536	Synaptophysin
9	9978.XP_004599433.1	0.525	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 15 Proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.542	molecular transducer activity
GO:0038023	0.515	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.981	biological regulation
GO:0050789	0.930	regulation of biological process
GO:0050794	0.763	regulation of cellular process
GO:0009987	0.744	cellular process
GO:0002376	0.680	immune system process
GO:0050896	0.540	response to stimulus
GO:0048518	0.535	positive regulation of biological process
GO:0019222	0.463	regulation of metabolic process
GO:0060255	0.451	regulation of macromolecule metabolic process
GO:0032501	0.447	multicellular organismal process
GO:0048583	0.313	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0043226	0.750	organelle
GO:0043227	0.738	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]