StarFunc result for job id Q6UX53

User Input

>input (244 residues)
MDILVPLLQLLVLLLTLPLHLMALLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFS
QIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYE
RFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPY
GSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMG
KAVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UX53	1.000	1.000	1.358E-54	244	1.000	1.000	Q6UX53.pdb.gz	TMT1B_HUMAN Thiol S-methyltransferase TMT1B OS=Homo sapiens OX=9606 GN=TMT1B PE=1 SV=2
2	AFDB:A0A024R118	0.981	0.981	7.428E-40	244	0.586	0.586	A0A024R118.pdb.gz
3	AFDB:Q38D36	0.589	0.390	2.804E-13	386	0.193	0.122	Q38D36.pdb.gz	Q38D36_TRYB2 Methyltransferase type 11 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4740 PE=4 SV=1
4	AFDB:O53532	0.546	0.395	1.583E-12	353	0.164	0.113	O53532.pdb.gz	Y2258_MYCTU S-adenosylmethionine-dependent methyltransferase Rv2258c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2258c PE=1 SV=1
5	PDB:5f8cB	0.543	0.383	1.912E-11	363	0.168	0.113	5f8cB.pdb.gz
6	AFDB:A0A1D8PLX3	0.562	0.324	3.703E-11	444	0.176	0.097	A0A1D8PLX3.pdb.gz	A0A1D8PLX3_CANAL RNA methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C403780CA PE=4 SV=1
7	AFDB:P34666	0.665	0.579	4.742E-11	285	0.160	0.137	P34666.pdb.gz	COQ5_CAEEL 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-5 PE=3 SV=2
8	AFDB:Q3ED65	0.593	0.559	5.708E-11	261	0.156	0.146	Q3ED65.pdb.gz	MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MENG PE=1 SV=2
9	AFDB:P49017	0.534	0.440	6.871E-11	307	0.156	0.124	P49017.pdb.gz	COQ5_YEAST 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ5 PE=1 SV=1
10	AFDB:O43033	0.672	0.662	7.776E-11	248	0.160	0.157	O43033.pdb.gz	YGU4_SCHPO Uncharacterized methyltransferase C3B9.04, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC3B9.04 PE=3 SV=1
11	PDB:5mgzA	0.540	0.566	8.966E-11	230	0.135	0.143	5mgzA.pdb.gz	Structural and Functional Basis of C-Methylation of Coumarin Scaffolds by NovO.
12	AFDB:P87230	0.594	0.488	9.360E-11	305	0.176	0.141	P87230.pdb.gz	COQ5_SCHPO 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq5 PE=3 SV=1
13	PDB:5wp5A	0.566	0.317	7.334E-10	463	0.139	0.073	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
14	PDB:5m58A	0.524	0.551	8.299E-10	230	0.131	0.139	5m58A.pdb.gz	Crystal Structure and Catalytic Mechanism of CouO, a Versatile C-Methyltransferase from Streptomyces rishiriensis.
15	PDB:5wp4A	0.507	0.271	8.299E-10	485	0.131	0.066	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
16	PDB:4kdcA	0.531	0.585	2.098E-9	217	0.152	0.171	4kdcA.pdb.gz
17	PDB:4iwnA	0.576	0.609	2.374E-9	229	0.160	0.170	4iwnA.pdb.gz	S-Adenosyl-S-carboxymethyl-L-homocysteine: a novel cofactor found in the putative tRNA-modifying enzyme CmoA.
18	PDB:4ineA	0.522	0.313	4.140E-9	431	0.119	0.067	4ineA.pdb.gz	Crystal structure of N-methyl transferase (PMT-2) from Caenorhabditis elegant complexed with S-adenosyl homocysteine and phosphoethanolamine
19	PDB:1x19A	0.481	0.351	4.404E-9	350	0.148	0.103	1x19A.pdb.gz
20	PDB:2ip2A	0.488	0.377	5.999E-9	330	0.135	0.100	2ip2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UX53	0.0	504	244	1.000	1.000	TMT1B_HUMAN Thiol S-methyltransferase TMT1B OS=Homo sapiens OX=9606 GN=TMT1B PE=1 SV=2
2	Q9H8H3	3.81e-108	313	244	0.586	0.586	TMT1A_HUMAN N6-adenosine-methyltransferase TMT1A OS=Homo sapiens OX=9606 GN=TMT1A PE=1 SV=1
3	F8VQX6	6.95e-82	244	180	0.455	0.617	F8VQX6_HUMAN Methyltransferase like 7A (Fragment) OS=Homo sapiens OX=9606 GN=TMT1A PE=1 SV=1
4	P38892	3.72e-09	58.2	291	0.135	0.113	CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRG1 PE=1 SV=1
5	Q38D36	4.52e-08	55.1	386	0.164	0.104	Q38D36_TRYB2 Methyltransferase type 11 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4740 PE=4 SV=1
6	A0A1D8PLX3	5.38e-07	52.0	444	0.180	0.099	A0A1D8PLX3_CANAL RNA methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C403780CA PE=4 SV=1
7	Q6DNE3	3.99e-06	50.1	2298	0.168	0.018	Q6DNE3_9CYAN CurJ OS=Lyngbya majuscula OX=158786 GN=curJ PE=1 SV=1
8	O43033	2.65e-05	46.6	248	0.201	0.198	YGU4_SCHPO Uncharacterized methyltransferase C3B9.04, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC3B9.04 PE=3 SV=1
9	Q06668	1.89e-04	44.3	471	0.139	0.072	OMS1_YEAST Methyltransferase OMS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OMS1 PE=1 SV=1
10	P49017	3.90e-04	43.1	307	0.135	0.107	COQ5_YEAST 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ5 PE=1 SV=1
11	E5KIC0	5.88e-04	42.4	245	0.148	0.147	CYPM_STRSQ Cypemycin N-terminal methyltransferase OS=Streptomyces sp. OX=1931 GN=cypM PE=1 SV=1
12	Q9HTB1	7.53e-04	42.4	278	0.131	0.115	Q9HTB1_PSEAE Methyltransferase type 11 domain-containing protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5459 PE=4 SV=1
13	O74386	0.001	41.2	248	0.127	0.125	TR141_SCHPO tRNA N(3)-methylcytidine methyltransferase trm141 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm141 PE=1 SV=1
14	Q5BEJ4	0.002	41.2	2527	0.152	0.015	AFOG_EMENI Asperfuranone polyketide synthase afoG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afoG PE=1 SV=1
15	Q9TYP1	0.003	40.4	334	0.152	0.111	STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans OX=6239 GN=strm-1 PE=1 SV=2
16	Q9Y7D5	0.004	40.4	2532	0.123	0.012	LOVF_ASPTE Lovastatin diketide synthase lovF OS=Aspergillus terreus OX=33178 GN=lovF PE=1 SV=1
17	Q0C8L6	0.006	40.0	2452	0.123	0.012	LOVF_ASPTN Lovastatin diketide synthase lovF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=lovF PE=1 SV=1
18	Q9P7L6	0.008	39.3	307	0.127	0.101	TR140_SCHPO tRNA N(3)-methylcytidine methyltransferase trm140 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm140 PE=1 SV=2
19	Q6P1Q9	0.022	38.1	378	0.148	0.095	MET2B_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2B OS=Homo sapiens OX=9606 GN=METTL2B PE=1 SV=3
20	Q96IZ6	0.024	37.7	378	0.143	0.093	MET2A_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2A OS=Homo sapiens OX=9606 GN=METTL2A PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01739 CheR	41	15.0	CheR methyltransferase, SAM binding domain
2	PF05219 DREV	3.2e+02	11.8	DREV methyltransferase
3	PF08241 Methyltransf_11	1.9e-17	75.0	Methyltransferase domain
4	PF08242 Methyltransf_12	3.6e-11	55.0	Methyltransferase domain
5	PF13489 Methyltransf_23	1.1e-12	59.6	Methyltransferase domain
6	PF13578 Methyltransf_24	11	18.5	Methyltransferase domain
7	PF13649 Methyltransf_25	3.5e-10	51.8	Methyltransferase domain
8	PF13847 Methyltransf_31	3.7e-08	44.8	Methyltransferase domain
9	PF05148 Methyltransf_8	0.13	23.7	Hypothetical methyltransferase
10	PF07021 MetW	12	17.0	Methionine biosynthesis protein MetW
11	PF01209 Ubie_methyltran	0.0076	27.2	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003807595.2

Rank	PPI partner	STRING score	Description
1	9597.XP_008958403.1	0.657	Belongs to the histone H2B family.
2	9597.XP_003824785.1	0.608	Transmembrane epididymal protein 1
3	9597.XP_003812141.1	0.562	DEAD-box helicase 55
4	9597.XP_003818849.1	0.560	HemK methyltransferase family member 1
5	9597.XP_003824259.1	0.558	Phospholipid phosphatase 3
6	9597.XP_008963467.1	0.549	Tetraspanin-1 isoform X1
7	9597.XP_003828619.1	0.507	tRNA methyltransferase 112 homolog
8	9597.XP_003805363.1	0.503	Farnesyl-diphosphate farnesyltransferase 1
9	9597.XP_008969315.1	0.503	occludin/ELL domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008757	0.999	S-adenosylmethionine-dependent methyltransferase activity
GO:0008172	0.959	S-methyltransferase activity
GO:0005488	0.798	binding
GO:0005515	0.729	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0071704	0.987	organic substance metabolic process
GO:0006807	0.738	nitrogen compound metabolic process
GO:0065007	0.597	biological regulation
GO:0044238	0.584	primary metabolic process
GO:0009058	0.499	biosynthetic process
GO:0044249	0.412	cellular biosynthetic process
GO:1901564	0.403	organonitrogen compound metabolic process
GO:1901360	0.394	organic cyclic compound metabolic process
GO:0050896	0.386	response to stimulus
GO:1901576	0.382	organic substance biosynthetic process
GO:0050789	0.359	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0043231	0.930	intracellular membrane-bounded organelle
GO:0005737	0.921	cytoplasm
GO:0070013	0.861	intracellular organelle lumen
GO:0005811	0.786	lipid droplet
GO:0012505	0.730	endomembrane system
GO:0016020	0.625	membrane
GO:0005576	0.320	extracellular region
GO:0005783	0.320	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.999	Methyltransferases.

[back to server]