StarFunc result for job id Q6UX72

User Input

>input (402 residues)
MRRRLRLRRDALLTLLLGASLGLLLYAQRDGAAPTASAPRGRGRAAPRPTPGPRAFQLPD
AGAAPPAYEGDTPAPPTPTGPFDFARYLRAKDQRRFPLLINQPHKCRGDGAPGGRPDLLI
AVKSVAEDFERRQAVRQTWGAEGRVQGALVRRVFLLGVPRGAGSGGADEVGEGARTHWRA
LLRAESLAYADILLWAFDDTFFNLTLKEIHFLAWASAFCPDVRFVFKGDADVFVNVGNLL
EFLAPRDPAQDLLAGDVIVHARPIRTRASKYYIPEAVYGLPAYPAYAGGGGFVLSGATLH
RLAGACAQVELFPIDDVFLGMCLQRLRLTPEPHPAFRTFGIPQPSAAPHLSTFDPCFYRE
LVVVHGLSAADIWLMWRLLHGPHGPACAHPQPVAAGPFQWDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZMB0	0.688	0.720	2.044E-40	384	0.368	0.385	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
2	AFDB:Q8NFL0	0.692	0.694	7.173E-40	401	0.410	0.411	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
3	AFDB:Q8K0J2	0.688	0.696	2.518E-39	397	0.403	0.408	Q8K0J2.pdb.gz	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
4	AFDB:Q9Y2A9	0.700	0.755	1.190E-36	372	0.361	0.390	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
5	AFDB:Q9C0J1	0.670	0.712	2.164E-36	378	0.396	0.421	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
6	PDB:7jhiC	0.649	0.785	3.363E-33	331	0.326	0.396	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
7	AFDB:Q9Z222	0.659	0.668	4.046E-33	397	0.368	0.373	Q9Z222.pdb.gz	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
8	AFDB:Q9NY97	0.658	0.666	8.041E-32	397	0.358	0.363	Q9NY97.pdb.gz	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
9	AFDB:Q7Z7M8	0.614	0.621	6.510E-29	397	0.323	0.327	Q7Z7M8.pdb.gz	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
10	AFDB:O54904	0.594	0.728	4.155E-28	326	0.239	0.294	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
11	AFDB:O43825	0.609	0.581	7.555E-28	422	0.254	0.242	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
12	PDB:4y63A	0.302	0.410	4.194E-5	282	0.100	0.142	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
13	PDB:6fxrA	0.300	0.190	1.870E-4	700	0.077	0.044	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
14	PDB:4fixA	0.319	0.217	5.167E-4	629	0.092	0.059	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
15	PDB:1ll0B	0.318	0.444	5.824E-4	267	0.112	0.169	1ll0B.pdb.gz
16	PDB:4hg6A	0.348	0.202	7.397E-4	747	0.122	0.066	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
17	PDB:8cvzI	0.300	0.424	1.609E-3	267	0.087	0.131	8cvzI.pdb.gz
18	PDB:3r2wC	0.233	0.213	3.106E-3	450	0.080	0.071	3r2wC.pdb.gz
19	PDB:2d7iA	0.268	0.210	3.501E-3	536	0.100	0.075	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
20	PDB:5vcmB	0.263	0.288	3.717E-3	358	0.060	0.067	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K0J2	2.00e-94	290	397	0.398	0.403	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
2	Q8NFL0	1.62e-93	288	401	0.400	0.401	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
3	Q9Z222	1.15e-75	242	397	0.351	0.355	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
4	Q9NY97	1.49e-75	241	397	0.336	0.340	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
5	Q6ZMB0	3.21e-75	240	384	0.376	0.393	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
6	Q9C0J1	7.92e-75	239	378	0.381	0.405	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
7	Q9Y2A9	6.18e-67	219	372	0.366	0.395	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
8	Q9BYG0	6.05e-43	156	378	0.229	0.243	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
9	Q99NB2	8.00e-43	155	377	0.234	0.249	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
10	O54904	3.39e-41	150	326	0.204	0.252	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
11	Q9Y5Z6	3.39e-41	150	326	0.204	0.252	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
12	O43825	1.15e-40	151	422	0.224	0.213	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
13	Q8BGY6	2.28e-40	149	376	0.231	0.247	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
14	O54905	2.63e-40	150	422	0.219	0.209	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
15	Q9JI67	3.74e-40	147	308	0.206	0.269	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
16	Q9Y2C3	2.17e-39	145	310	0.204	0.265	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
17	Q7Z7M8	4.40e-39	146	397	0.279	0.282	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
18	Q920V1	2.77e-33	129	331	0.201	0.245	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
19	O75752	2.91e-33	129	331	0.204	0.248	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
20	O96024	3.96e-30	121	378	0.251	0.267	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02434 Fringe	0.036	25.1	Fringe-like
2	PF01762 Galactosyl_T	4.4e-33	126.3	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302716	0.903	Mucin-17
2	9606.ENSP00000484824	0.902	Mucin-1
3	9606.ENSP00000414350	0.901	Mucin-20
4	9606.ENSP00000311364	0.900	Mucin-like protein 1
5	9606.ENSP00000365473	0.900	Mucin-21
6	9606.ENSP00000368771	0.900	Mucin-3A
7	9606.ENSP00000381008	0.900	Mucin-16
8	9606.ENSP00000406861	0.900	Mucin-6
9	9606.ENSP00000407422	0.900	Mucin-7
10	9606.ENSP00000416753	0.900	Mucin-15
11	9606.ENSP00000417498	0.900	Mucin-4
12	9606.ENSP00000436812	0.900	Mucin-5B
13	9606.ENSP00000441929	0.900	Mucin-12
14	9606.ENSP00000485028	0.900	Mucin-13
15	9606.ENSP00000485659	0.900	Mucin-5AC
16	9606.ENSP00000308022	0.698	Transcriptional adapter 2-beta
17	9606.ENSP00000413632	0.685	Minichromosome maintenance domain-containing protein 2
18	9606.ENSP00000226021	0.603	Voltage-dependent calcium channel gamma-1 subunit
19	9606.ENSP00000382646	0.542	Protein FAM166B
20	9606.ENSP00000358737	0.525	ATP synthase F(0) complex subunit B1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048531	1.000	beta-1,3-galactosyltransferase activity
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0008499	0.984	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
GO:0008375	0.972	acetylglucosaminyltransferase activity
GO:0005488	0.969	binding
GO:0005515	0.947	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:1901576	0.996	organic substance biosynthetic process
GO:0006023	0.989	aminoglycan biosynthetic process
GO:0034645	0.988	cellular macromolecule biosynthetic process
GO:0044238	0.986	primary metabolic process
GO:0009101	0.961	glycoprotein biosynthetic process
GO:0043413	0.931	macromolecule glycosylation
GO:0006486	0.917	protein glycosylation
GO:0030203	0.571	glycosaminoglycan metabolic process
GO:0006024	0.532	glycosaminoglycan biosynthetic process
GO:0006493	0.368	protein O-linked glycosylation
GO:0005975	0.360	carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0005576	0.860	extracellular region
GO:0005615	0.714	extracellular space
GO:0043230	0.612	extracellular organelle
GO:0070062	0.582	extracellular exosome
GO:0070013	0.511	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]