StarFunc result for job id Q6UXB2

User Input

>input (119 residues)
MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAP
RRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXB2	1.000	1.000	1.618E-19	119	1.000	1.000	Q6UXB2.pdb.gz	CXL17_HUMAN C-X-C motif chemokine 17 OS=Homo sapiens OX=9606 GN=CXCL17 PE=1 SV=1
2	AFDB:Q5UW37	0.724	0.724	1.277E-11	119	0.714	0.714	Q5UW37.pdb.gz	CXL17_MOUSE C-X-C motif chemokine 17 OS=Mus musculus OX=10090 GN=Cxcl17 PE=2 SV=1
3	AFDB:Q57WD4	0.120	0.045	5.565	453	0.084	0.022	Q57WD4.pdb.gz	Q57WD4_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.190 PE=4 SV=1
4	AFDB:Q9MAB2	0.199	0.166	5.565	144	0.176	0.146	Q9MAB2.pdb.gz	Q9MAB2_ARATH At3g05070 OS=Arabidopsis thaliana OX=3702 GN=At3g05070 PE=1 SV=1
5	AFDB:A8WFW7	0.183	0.056	5.955	419	0.084	0.024	A8WFW7.pdb.gz	A8WFW7_DANRE Forkhead box P3 OS=Danio rerio OX=7955 GN=foxp3 PE=2 SV=1
6	AFDB:P61312	0.169	0.139	5.955	146	0.160	0.130	P61312.pdb.gz	ADM2_RAT Protein ADM2 OS=Rattus norvegicus OX=10116 GN=Adm2 PE=1 SV=1
7	AFDB:Q8NFL0	0.202	0.069	5.955	401	0.126	0.037	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
8	AFDB:Q8RWT4	0.185	0.062	5.955	415	0.160	0.046	Q8RWT4.pdb.gz	Q8RWT4_ARATH Large ribosomal subunit protein uL1c OS=Arabidopsis thaliana OX=3702 GN=At2g42710 PE=1 SV=1
9	AFDB:Q9BVX2	0.151	0.086	6.373	250	0.176	0.084	Q9BVX2.pdb.gz	T106C_HUMAN Transmembrane protein 106C OS=Homo sapiens OX=9606 GN=TMEM106C PE=1 SV=1
10	AFDB:P60985	0.195	0.232	6.821	99	0.109	0.131	P60985.pdb.gz	KTDAP_HUMAN Keratinocyte differentiation-associated protein OS=Homo sapiens OX=9606 GN=KRTDAP PE=1 SV=1
11	PDB:5dgeSM	0.169	0.132	9.159	159	0.126	0.094	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXB2	1.92e-84	243	119	1.000	1.000	CXL17_HUMAN C-X-C motif chemokine 17 OS=Homo sapiens OX=9606 GN=CXCL17 PE=1 SV=1
2	Q5UW37	1.45e-50	157	119	0.714	0.714	CXL17_MOUSE C-X-C motif chemokine 17 OS=Mus musculus OX=10090 GN=Cxcl17 PE=2 SV=1
3	Q6PH97	1.6	30.0	414	0.118	0.034	Q6PH97_MOUSE Cabin1 protein (Fragment) OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
4	F1QI87	1.7	30.4	2055	0.126	0.007	F1QI87_DANRE GON-4-like protein OS=Danio rerio OX=7955 GN=fb99g07 PE=4 SV=1
5	Q9UBL3	2.5	29.6	628	0.143	0.027	ASH2L_HUMAN Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1
6	Q91X20	2.6	29.6	623	0.143	0.027	ASH2L_MOUSE Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Mus musculus OX=10090 GN=Ash2l PE=1 SV=1
7	Q9C102	2.6	29.6	2111	0.126	0.007	GLT1_SCHPO Glutamate synthase [NADH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glt1 PE=1 SV=1
8	M9PCM0	2.9	29.6	659	0.084	0.015	M9PCM0_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9525 PE=4 SV=1
9	Q9VLG5	2.9	29.6	678	0.084	0.015	Q9VLG5_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=gi7297470 PE=4 SV=1
10	Q3TDW4	3.4	29.3	606	0.118	0.023	Q3TDW4_MOUSE Calcineurin-binding protein cabin-1 MEF2-binding domain-containing protein OS=Mus musculus OX=10090 GN=Cabin1 PE=2 SV=1
11	E7EXM8	8.9	28.1	1603	0.109	0.008	E7EXM8_DANRE DEP domain-containing 5, GATOR1 subcomplex subunit OS=Danio rerio OX=7955 GN=depdc5 PE=1 SV=2
12	Q8TDY4	9.2	28.1	903	0.084	0.011	ASAP3_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ASAP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15211 CXCL17	7.8e-49	175.7	VEGF co-regulated chemokine 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000472467

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000411788	0.803	G-protein coupled receptor 35
2	9606.ENSP00000219244	0.676	C-C motif chemokine 17
3	9606.ENSP00000337065	0.652	C-X-C motif chemokine 14
4	9606.ENSP00000478024	0.646	C-C motif chemokine 16
5	9606.ENSP00000292301	0.630	C-C chemokine receptor type 2
6	9606.ENSP00000375086	0.625	C-C motif chemokine 25
7	9606.ENSP00000474412	0.549	C-C motif chemokine 5
8	9606.ENSP00000479955	0.548	C-C motif chemokine 18
9	9606.ENSP00000356793	0.541	Cytokine SCM-1 beta
10	9606.ENSP00000305651	0.518	C-X-C motif chemokine 10
11	9606.ENSP00000354901	0.515	C-X-C motif chemokine 9
12	9606.ENSP00000351671	0.512	C-C motif chemokine 20
13	9606.ENSP00000225831	0.502	C-C motif chemokine 2
14	9606.ENSP00000293778	0.501	C-X-C motif chemokine 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0048018	0.485	receptor ligand activity
GO:0001664	0.396	G protein-coupled receptor binding
GO:0005125	0.393	cytokine activity
GO:0005126	0.353	cytokine receptor binding
GO:0008009	0.319	chemokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0071677	0.979	positive regulation of mononuclear cell migration
GO:0002690	0.979	positive regulation of leukocyte chemotaxis
GO:0048519	0.923	negative regulation of biological process
GO:0080134	0.877	regulation of response to stress
GO:0050896	0.844	response to stimulus
GO:0071622	0.823	regulation of granulocyte chemotaxis
GO:0009987	0.820	cellular process
GO:0051239	0.818	regulation of multicellular organismal process
GO:0010604	0.801	positive regulation of macromolecule metabolic process
GO:0009966	0.800	regulation of signal transduction
GO:0009605	0.786	response to external stimulus
GO:1905521	0.783	regulation of macrophage migration
GO:0042221	0.775	response to chemical
GO:0051716	0.772	cellular response to stimulus
GO:0006935	0.770	chemotaxis
GO:0002376	0.769	immune system process
GO:0050727	0.754	regulation of inflammatory response
GO:0010468	0.739	regulation of gene expression
GO:1902531	0.705	regulation of intracellular signal transduction
GO:0010628	0.641	positive regulation of gene expression
GO:0009967	0.625	positive regulation of signal transduction
GO:0048585	0.588	negative regulation of response to stimulus
GO:0001817	0.582	regulation of cytokine production
GO:0070887	0.431	cellular response to chemical stimulus
GO:0043408	0.430	regulation of MAPK cascade
GO:0050900	0.420	leukocyte migration
GO:1902533	0.412	positive regulation of intracellular signal transduction
GO:0031348	0.402	negative regulation of defense response
GO:0060326	0.400	cell chemotaxis
GO:0051240	0.396	positive regulation of multicellular organismal process
GO:0030595	0.393	leukocyte chemotaxis
GO:0006950	0.341	response to stress
GO:0006952	0.333	defense response
GO:0098542	0.322	defense response to other organism
GO:0070374	0.314	positive regulation of ERK1 and ERK2 cascade
GO:0090026	0.312	positive regulation of monocyte chemotaxis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]