StarFunc result for job id Q6UXB4

User Input

>input (293 residues)
MDTTRYSKWGGSSEEVPGGPWGRWVHWSRRPLFLALAVLVTTVLWAVILSILLSKASTER
AALLDGHDLLRTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQE
SALRELRERVTQGLAEAGRGREDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFS
VPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWV
DGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKRHNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXB4	1.000	1.000	3.545E-48	293	1.000	1.000	Q6UXB4.pdb.gz	CLC4G_HUMAN C-type lectin domain family 4 member G OS=Homo sapiens OX=9606 GN=CLEC4G PE=1 SV=1
2	AFDB:Q8BNX1	0.570	0.568	1.050E-33	294	0.601	0.599	Q8BNX1.pdb.gz	CLC4G_MOUSE C-type lectin domain family 4 member G OS=Mus musculus OX=10090 GN=Clec4g PE=1 SV=1
3	AFDB:Q8JZN1	0.400	0.361	3.180E-16	332	0.270	0.238	Q8JZN1.pdb.gz	Q8JZN1_MOUSE Macrophage galactose N-acetyl-galactosamine specific lectin 2 OS=Mus musculus OX=10090 GN=Mgl2 PE=1 SV=1
4	AFDB:P06734	0.449	0.412	5.809E-16	321	0.266	0.243	P06734.pdb.gz	FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor OS=Homo sapiens OX=9606 GN=FCER2 PE=1 SV=1
5	AFDB:Q6ZS10	0.422	0.330	8.339E-16	378	0.229	0.177	Q6ZS10.pdb.gz	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
6	AFDB:P20693	0.429	0.382	9.991E-16	331	0.283	0.251	P20693.pdb.gz	FCER2_MOUSE Low affinity immunoglobulin epsilon Fc receptor OS=Mus musculus OX=10090 GN=Fcer2 PE=1 SV=1
7	AFDB:D3Z1H5	0.414	0.442	3.139E-15	274	0.253	0.270	D3Z1H5.pdb.gz	D3Z1H5_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
8	AFDB:P49300	0.403	0.393	4.243E-15	304	0.287	0.276	P49300.pdb.gz	CLC10_MOUSE C-type lectin domain family 10 member A OS=Mus musculus OX=10090 GN=Clec10a PE=1 SV=1
9	AFDB:P07307	0.409	0.386	5.735E-15	311	0.242	0.228	P07307.pdb.gz	ASGR2_HUMAN Asialoglycoprotein receptor 2 OS=Homo sapiens OX=9606 GN=ASGR2 PE=1 SV=2
10	AFDB:P07306	0.412	0.415	7.751E-15	291	0.232	0.234	P07306.pdb.gz	ASGR1_HUMAN Asialoglycoprotein receptor 1 OS=Homo sapiens OX=9606 GN=ASGR1 PE=1 SV=2
11	PDB:7wz8A	0.396	0.632	2.236E-12	180	0.195	0.317	7wz8A.pdb.gz
12	PDB:5f2qB	0.396	0.826	5.065E-10	135	0.116	0.252	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
13	PDB:1qddA	0.388	0.760	8.203E-10	144	0.113	0.229	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
14	PDB:7qsrA	0.399	0.090	3.484E-9	1335	0.116	0.025	7qsrA.pdb.gz
15	PDB:1htnA	0.374	0.683	7.179E-9	156	0.096	0.179	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
16	PDB:1bj3A	0.316	0.684	1.883E-8	129	0.119	0.271	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
17	PDB:7jptA	0.369	0.085	2.256E-8	1327	0.106	0.023	7jptA.pdb.gz
18	PDB:2kv3A	0.336	0.680	3.439E-8	131	0.102	0.229	2kv3A.pdb.gz
19	PDB:3bx4C	0.325	0.677	3.653E-8	134	0.106	0.231	3bx4C.pdb.gz
20	PDB:1gz2A	0.372	0.747	3.880E-8	139	0.096	0.201	1gz2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXB4	0.0	601	293	1.000	1.000	CLC4G_HUMAN C-type lectin domain family 4 member G OS=Homo sapiens OX=9606 GN=CLEC4G PE=1 SV=1
2	Q8BNX1	1.25e-126	364	294	0.642	0.639	CLC4G_MOUSE C-type lectin domain family 4 member G OS=Mus musculus OX=10090 GN=Clec4g PE=1 SV=1
3	Q91ZW9	1.97e-30	114	178	0.212	0.348	C209C_MOUSE CD209 antigen-like protein C OS=Mus musculus OX=10090 GN=Cd209c PE=2 SV=1
4	P20693	1.85e-26	108	331	0.266	0.236	FCER2_MOUSE Low affinity immunoglobulin epsilon Fc receptor OS=Mus musculus OX=10090 GN=Fcer2 PE=1 SV=1
5	P06734	2.48e-26	107	321	0.229	0.209	FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor OS=Homo sapiens OX=9606 GN=FCER2 PE=1 SV=1
6	Q7TSU6	2.50e-24	100	260	0.191	0.215	Q7TSU6_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
7	Q4KL16	2.88e-24	100	262	0.191	0.214	Q4KL16_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
8	G3UVT9	2.96e-24	100	255	0.191	0.220	G3UVT9_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
9	D3Z1H5	4.11e-24	100	274	0.191	0.204	D3Z1H5_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
10	Q80ZY1	6.16e-24	100	277	0.191	0.202	Q80ZY1_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
11	Q91ZX1	6.44e-24	99.4	238	0.181	0.223	C209A_MOUSE CD209 antigen-like protein A OS=Mus musculus OX=10090 GN=Cd209a PE=2 SV=1
12	Q8CJ91	7.30e-24	100	325	0.300	0.271	C209B_MOUSE CD209 antigen-like protein B OS=Mus musculus OX=10090 GN=Cd209b PE=1 SV=2
13	Q9H2X3	2.57e-23	100	399	0.249	0.183	CLC4M_HUMAN C-type lectin domain family 4 member M OS=Homo sapiens OX=9606 GN=CLEC4M PE=1 SV=1
14	D3Z5D4	5.08e-23	95.5	194	0.181	0.273	D3Z5D4_MOUSE CD209g antigen OS=Mus musculus OX=10090 GN=Cd209g PE=4 SV=1
15	P24721	6.83e-23	97.8	301	0.270	0.262	ASGR2_MOUSE Asialoglycoprotein receptor 2 OS=Mus musculus OX=10090 GN=Asgr2 PE=1 SV=1
16	Q14FK5	2.60e-22	95.1	255	0.181	0.208	Q14FK5_MOUSE SIGNR7 protein OS=Mus musculus OX=10090 GN=Cd209g PE=2 SV=1
17	Q91ZW8	1.29e-21	93.2	237	0.188	0.232	C209D_MOUSE CD209 antigen-like protein D OS=Mus musculus OX=10090 GN=Cd209d PE=2 SV=1
18	Q8K4Q8	3.68e-21	95.5	742	0.174	0.069	COL12_MOUSE Collectin-12 OS=Mus musculus OX=10090 GN=Colec12 PE=1 SV=1
19	Q9NNX6	4.10e-21	94.4	404	0.249	0.181	CD209_HUMAN CD209 antigen OS=Homo sapiens OX=9606 GN=CD209 PE=1 SV=1
20	Q91ZW7	1.19e-20	89.7	208	0.174	0.245	C209E_MOUSE CD209 antigen-like protein E OS=Mus musculus OX=10090 GN=Cd209e PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	5.4	18.7	Autophagy protein 16 (ATG16)
2	PF19220 Crescentin	30	15.1	Crescentin protein
3	PF00038 Filament	73	14.4	Intermediate filament protein
4	PF09787 Golgin_A5	3.2e+02	12.2	Golgin subfamily A member 5
5	PF00059 Lectin_C	5.6e-11	54.5	Lectin C-type domain
6	PF07926 TPR_MLP1_2	76	14.8	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327599

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000203629	0.973	Lymphocyte activation gene 3 protein
2	9606.ENSP00000398632	0.937	CD44 antigen
3	9606.ENSP00000216044	0.770	GTP-binding protein 1
4	9606.ENSP00000198536	0.646	Paired immunoglobulin-like type 2 receptor alpha
5	9606.ENSP00000263798	0.598	Tyrosine-protein kinase receptor TYRO3
6	9606.ENSP00000383115	0.553	Collectin-12
7	9606.ENSP00000160262	0.544	Intercellular adhesion molecule 3
8	9606.ENSP00000381133	0.522	Fibrinogen-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030246	1.000	carbohydrate binding
GO:0005515	1.000	protein binding
GO:0097367	0.998	carbohydrate derivative binding
GO:0036094	0.998	small molecule binding
GO:0001618	0.998	virus receptor activity
GO:0048029	0.975	monosaccharide binding
GO:0005537	0.963	mannose binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0044419	0.947	biological process involved in interspecies interaction between organisms
GO:0048518	0.931	positive regulation of biological process
GO:0050794	0.870	regulation of cellular process
GO:0009987	0.864	cellular process
GO:0050792	0.860	regulation of viral process
GO:0050896	0.780	response to stimulus
GO:0016032	0.752	viral process
GO:0019058	0.711	viral life cycle
GO:0046718	0.693	viral entry into host cell
GO:0048519	0.371	negative regulation of biological process
GO:0002682	0.356	regulation of immune system process
GO:0002376	0.347	immune system process
GO:0048583	0.336	regulation of response to stimulus
GO:0048524	0.319	positive regulation of viral process
GO:0048522	0.310	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.927	organelle
GO:0043227	0.910	membrane-bounded organelle
GO:0031982	0.874	vesicle
GO:0043231	0.787	intracellular membrane-bounded organelle
GO:0005737	0.679	cytoplasm
GO:0098588	0.575	bounding membrane of organelle
GO:0031410	0.521	cytoplasmic vesicle
GO:0012505	0.444	endomembrane system
GO:0030659	0.422	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]