StarFunc result for job id Q6UXB8

User Input

>input (463 residues)
MHGSCSFLMLLLPLLLLLVATTGPVGALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWD
EELAAFAKAYARQCVWGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATC
SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEG
TPCSQCPSGYHCKNSLCEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGI
PAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVTTEVPSILAAHSLPSL
DEEPVTFPKSTHVPIPKSADKVTDKTKVPSRSPENSLDPKMSLTGARELLPHAQEEAEAE
AELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGGRALALQS
SLPGAEGPDKPSVVSGLNSGPGHVWGPLLGLLLLPPLVLAGIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXB8	0.999	0.999	6.946E-79	463	1.000	1.000	Q6UXB8.pdb.gz	PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=PI16 PE=1 SV=1
2	AFDB:Q9ET66	0.458	0.427	2.658E-51	498	0.665	0.618	Q9ET66.pdb.gz	PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2
3	AFDB:P47033	0.269	0.149	1.910E-12	881	0.218	0.115	P47033.pdb.gz	PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRY3 PE=1 SV=1
4	PDB:4aiwA	0.267	0.764	1.180E-8	151	0.078	0.238	4aiwA.pdb.gz
5	PDB:6hiwDR	0.077	0.116	6.143E-1	251	0.069	0.127	6hiwDR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
6	PDB:1rblA	0.079	0.078	8.965E-1	467	0.028	0.028	1rblA.pdb.gz	Structure determination and refinement of ribulose 1,5-bisphosphate carboxylase/oxygenase from Synechococcus PCC6301.
7	PDB:1wddA	0.090	0.089	1.793	465	0.030	0.030	1wddA.pdb.gz	Crystal structure of rice Rubisco and implications for activation induced by positive effectors NADPH and 6-phosphogluconate
8	PDB:4uirA	0.076	0.059	1.793	641	0.032	0.023	4uirA.pdb.gz	Structure-Based Mechanism of Oleate Hydratase from Elizabethkingia Meningoseptica.
9	AFDB:Q2KT54	0.098	0.094	1.847	496	0.132	0.123	Q2KT54.pdb.gz
10	PDB:3zxwA	0.078	0.078	1.909	464	0.030	0.030	3zxwA.pdb.gz	Structure of Ribulose-1,5-Bisphosphate Carboxylase Oxygenase from Thermosynechococcus Elongatus
11	PDB:4qi7A	0.057	0.041	2.166	805	0.041	0.024	4qi7A.pdb.gz	Structural basis for cellobiose dehydrogenase action during oxidative cellulose degradation.
12	PDB:7kgbc	0.091	0.172	2.307	207	0.030	0.068	7kgbc.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
13	AFDB:Q57VA3	0.073	0.058	2.377	618	0.093	0.070	Q57VA3.pdb.gz	Q57VA3_TRYB2 CFA20 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.30H13.870 PE=4 SV=1
14	PDB:7eqgD	0.061	0.081	2.787	309	0.039	0.058	7eqgD.pdb.gz	AcrIF5 specifically targets DNA-bound CRISPR-Cas surveillance complex for inhibition.
15	AFDB:M9ND53	0.065	0.022	2.871	2047	0.104	0.023	M9ND53.pdb.gz	M9ND53_DROME Taiman, isoform G OS=Drosophila melanogaster OX=7227 GN=tai PE=1 SV=1
16	AFDB:Q27403	0.076	0.071	3.058	504	0.112	0.103	Q27403.pdb.gz	GCM_DROME Transcription factor glial cells missing OS=Drosophila melanogaster OX=7227 GN=gcm PE=1 SV=2
17	AFDB:Q61191	0.074	0.025	3.257	2045	0.125	0.028	Q61191.pdb.gz	HCFC1_MOUSE Host cell factor 1 OS=Mus musculus OX=10090 GN=Hcfc1 PE=1 SV=2
18	AFDB:Q80XH2	0.092	0.048	3.257	1243	0.134	0.050	Q80XH2.pdb.gz	IMPG2_MOUSE Interphotoreceptor matrix proteoglycan 2 OS=Mus musculus OX=10090 GN=Impg2 PE=1 SV=1
19	AFDB:Q8N3D4	0.090	0.044	3.257	1523	0.149	0.045	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
20	PDB:3bviF	0.045	0.111	3.819	173	0.015	0.040	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXB8	0.0	944	463	1.000	1.000	PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=PI16 PE=1 SV=1
2	Q9ET66	0.0	541	498	0.639	0.594	PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2
3	Q9DAG6	3.42e-36	135	236	0.177	0.347	GPRL1_MOUSE GLIPR1-like protein 1 OS=Mus musculus OX=10090 GN=Glipr1l1 PE=1 SV=1
4	P48060	8.06e-34	130	266	0.143	0.248	GLIP1_HUMAN Glioma pathogenesis-related protein 1 OS=Homo sapiens OX=9606 GN=GLIPR1 PE=1 SV=3
5	Q8BZQ2	6.33e-32	129	495	0.166	0.156	CRLD2_MOUSE Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus OX=10090 GN=Crispld2 PE=1 SV=1
6	Q9H0B8	6.92e-32	129	497	0.158	0.147	CRLD2_HUMAN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Homo sapiens OX=9606 GN=CRISPLD2 PE=2 SV=1
7	O43692	1.13e-31	124	258	0.147	0.264	PI15_HUMAN Peptidase inhibitor 15 OS=Homo sapiens OX=9606 GN=PI15 PE=1 SV=1
8	A0A0G2JUW3	4.84e-31	127	498	0.160	0.149	A0A0G2JUW3_RAT Cysteine-rich secretory protein LCCL domain containing 2 OS=Rattus norvegicus OX=10116 GN=Crispld2 PE=4 SV=1
9	A0A0G2JYX8	1.30e-30	118	178	0.153	0.399	A0A0G2JYX8_RAT Cysteine-rich secretory protein LCCL domain containing 2 OS=Rattus norvegicus OX=10116 GN=Crispld2 PE=3 SV=2
10	Q9Z0U6	3.56e-30	117	188	0.153	0.378	Q9Z0U6_RAT Late gestation lung protein 1 OS=Rattus norvegicus OX=10116 GN=Crispld2 PE=2 SV=1
11	Q9H336	2.22e-27	116	500	0.153	0.142	CRLD1_HUMAN Cysteine-rich secretory protein LCCL domain-containing 1 OS=Homo sapiens OX=9606 GN=CRISPLD1 PE=2 SV=1
12	Q8CGD2	4.74e-27	115	500	0.153	0.142	CRLD1_MOUSE Cysteine-rich secretory protein LCCL domain-containing 1 OS=Mus musculus OX=10090 GN=Crispld1 PE=2 SV=1
13	O88205	2.31e-26	108	243	0.149	0.284	O88205_RAT Cysteine-rich secretory protein 2 OS=Rattus norvegicus OX=10116 GN=Crisp2 PE=2 SV=1
14	P54108	2.93e-26	108	245	0.149	0.282	CRIS3_HUMAN Cysteine-rich secretory protein 3 OS=Homo sapiens OX=9606 GN=CRISP3 PE=1 SV=1
15	P84808	4.15e-26	108	238	0.143	0.277	CRVP2_NAJKA Cysteine-rich venom protein kaouthin-2 OS=Naja kaouthia OX=8649 PE=1 SV=2
16	P16562	1.07e-24	104	243	0.151	0.288	CRIS2_HUMAN Cysteine-rich secretory protein 2 OS=Homo sapiens OX=9606 GN=CRISP2 PE=1 SV=1
17	P84805	2.01e-24	103	239	0.147	0.285	CRVP1_NAJKA Cysteine-rich venom protein kaouthin-1 OS=Naja kaouthia OX=8649 PE=1 SV=2
18	F7C0L1	1.06e-22	97.8	204	0.145	0.328	CRISA_XENTR Allurin OS=Xenopus tropicalis OX=8364 GN=crisp-a PE=1 SV=2
19	Q4G1C9	1.55e-21	97.4	344	0.117	0.157	GRPL2_HUMAN GLIPR1-like protein 2 OS=Homo sapiens OX=9606 GN=GLIPR1L2 PE=1 SV=2
20	Q9ZNS4	2.33e-21	92.8	161	0.132	0.379	PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=PRB1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00188 CAP	1.8e-16	72.6	Cysteine-rich secretory protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362778

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481699	0.758	Serpin peptidase inhibitors
2	9606.ENSP00000341584	0.732	Serpin B13
3	9606.ENSP00000463092	0.703	Beta-microseminoprotein
4	9606.ENSP00000322061	0.661	Complement component C7
5	9606.ENSP00000463027	0.624	Nuclear receptor coactivator 4
6	9606.ENSP00000303148	0.556	Voltage-dependent calcium channel gamma-like subunit
7	9606.ENSP00000314151	0.536	Prostate-specific antigen
8	9606.ENSP00000415769	0.531	Inter-alpha-trypsin inhibitor heavy chain H3
9	9606.ENSP00000448012	0.525	Centrosomal protein of 290 kDa
10	9606.ENSP00000320147	0.522	Histone-lysine N-methyltransferase EZH2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.978	regulation of biological process
GO:0048583	0.961	regulation of response to stimulus
GO:0050794	0.960	regulation of cellular process
GO:0048519	0.873	negative regulation of biological process
GO:0048523	0.861	negative regulation of cellular process
GO:0040008	0.789	regulation of growth
GO:0051239	0.780	regulation of multicellular organismal process
GO:0090257	0.635	regulation of muscle system process
GO:0014743	0.631	regulation of muscle hypertrophy
GO:0045926	0.589	negative regulation of growth
GO:0048638	0.556	regulation of developmental growth
GO:0051128	0.534	regulation of cellular component organization
GO:0051093	0.519	negative regulation of developmental process
GO:0009987	0.476	cellular process
GO:0045595	0.469	regulation of cell differentiation
GO:0043502	0.461	regulation of muscle adaptation
GO:0048640	0.421	negative regulation of developmental growth
GO:0001558	0.407	regulation of cell growth
GO:0050896	0.381	response to stimulus
GO:0051241	0.321	negative regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0043227	0.966	membrane-bounded organelle
GO:0043229	0.955	intracellular organelle
GO:0043231	0.950	intracellular membrane-bounded organelle
GO:0005737	0.902	cytoplasm
GO:0031982	0.878	vesicle
GO:0070062	0.857	extracellular exosome
GO:0012505	0.718	endomembrane system
GO:0070013	0.557	intracellular organelle lumen
GO:0016020	0.428	membrane
GO:0031410	0.338	cytoplasmic vesicle
GO:0071944	0.301	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]