StarFunc result for job id Q6UXC1

User Input

>input (1216 residues)
MPLSSHLLPALVLFLAGSSGWAWVPNHCRSPGQAVCNFVCDCRDCSDEAQCGYHGASPTL
GAPFACDFEQDPCGWRDISTSGYSWLRDRAGAALEGPGPHSDHTLGTDLGWYMAVGTHRG
KEASTAALRSPTLREAASSCKLRLWYHAASGDVAELRVELTHGAETLTLWQSTGPWGPGW
QELAVTTGRIRGDFRVTFSATRNATHRGAVALDDLEFWDCGLPTPQANCPPGHHHCQNKV
CVEPQQLCDGEDNCGDLSDENPLTCGRHIATDFETGLGPWNRSEGWSRNHRAGGPERPSW
PRRDHSRNSAQGSFLVSVAEPGTPAILSSPEFQASGTSNCSLVFYQYLSGSEAGCLQLFL
QTLGPGAPRAPVLLRRRRGELGTAWVRDRVDIQSAYPFQILLAGQTGPGGVVGLDDLILS
DHCRPVSEVSTLQPLPPGPRAPAPQPLPPSSRLQDSCKQGHLACGDLCVPPEQLCDFEEQ
CAGGEDEQACGTTDFESPEAGGWEDASVGRLQWRRVSAQESQGSSAAAAGHFLSLQRAWG
QLGAEARVLTPLLGPSGPSCELHLAYYLQSQPRGFLALVVVDNGSRELAWQALSSSAGIW
KVDKVLLGARRRPFRLEFVGLVDLDGPDQQGAGVDNVTLRDCSPTVTTERDREVSCNFER
DTCSWYPGHLSDTHWRWVESRGPDHDHTTGQGHFVLLDPTDPLAWGHSAHLLSRPQVPAA
PTECLSFWYHLHGPQIGTLRLAMRREGEETHLWSRSGTQGNRWHEAWATLSHQPGSHAQY
QLLFEGLRDGYHGTMALDDVAVRPGPCWAPNYCSFEDSDCGFSPGGQGLWRRQANASGHA
AWGPPTDHTTETAQGHYMVVDTSPDALPRGQTASLTSKEHRPLAQPACLTFWYHGSLRSP
GTLRVYLEERGRHQVLSLSAHGGLAWRLGSMDVQAERAWRVVFEAVAAGVAHSYVALDDL
LLQDGPCPQPGSCDFESGLCGWSHLAWPGLGGYSWDWGGGATPSRYPQPPVDHTLGTEAG
HFAFFETGVLGPGGRAAWLRSEPLPATPASCLRFWYHMGFPEHFYKGELKVLLHSAQGQL
AVWGAGGHRRHQWLEAQVEVASAKEFQIVFEATLGGQPALGPIALDDVEYLAGQHCQQPA
PSPGNTAAPGSVPAVVGSALLLLMLLVLLGLGGRRWLQKKGSCPFQSNTEATAPGFDNIL
FNADGVTLPASVTSDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63191	0.907	0.907	0.000	1216	0.723	0.723	Q63191.pdb.gz	AEGP_RAT Apical endosomal glycoprotein OS=Rattus norvegicus OX=10116 GN=Mamdc4 PE=1 SV=1
2	AFDB:A2AJX4	0.284	0.166	9.185E-75	2123	0.248	0.142	A2AJX4.pdb.gz	MALR1_MOUSE MAM and LDL-receptor class A domain-containing protein 1 OS=Mus musculus OX=10090 GN=Malrd1 PE=1 SV=2
3	AFDB:Q5VYJ5	0.285	0.164	9.845E-74	2156	0.251	0.141	Q5VYJ5.pdb.gz	MALR1_HUMAN MAM and LDL-receptor class A domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MALRD1 PE=1 SV=4
4	AFDB:Q7Z304	0.151	0.250	2.101E-40	686	0.125	0.222	Q7Z304.pdb.gz	MAMC2_HUMAN MAM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAMDC2 PE=1 SV=3
5	AFDB:Q8CG85	0.151	0.250	9.253E-40	686	0.119	0.211	Q8CG85.pdb.gz	MAMC2_MOUSE MAM domain-containing protein 2 OS=Mus musculus OX=10090 GN=Mamdc2 PE=1 SV=1
6	AFDB:B3DFP6	0.121	0.146	2.470E-22	927	0.113	0.149	B3DFP6.pdb.gz
7	AFDB:P98072	0.170	0.195	2.596E-22	1035	0.097	0.114	P98072.pdb.gz	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
8	AFDB:P98073	0.171	0.197	4.470E-22	1019	0.083	0.099	P98073.pdb.gz	ENTK_HUMAN Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3
9	AFDB:O35375	0.112	0.134	2.648E-21	931	0.093	0.121	O35375.pdb.gz	NRP2_MOUSE Neuropilin-2 OS=Mus musculus OX=10090 GN=Nrp2 PE=1 SV=2
10	AFDB:Q6T491	0.119	0.149	5.838E-21	921	0.105	0.139	Q6T491.pdb.gz
11	PDB:6vlsD	0.091	0.112	5.618E-9	963	0.038	0.048	6vlsD.pdb.gz
12	PDB:4bxsV	0.086	0.083	4.017E-6	1262	0.033	0.032	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
13	PDB:1ipkC	0.062	0.142	4.659E-6	379	0.034	0.108	1ipkC.pdb.gz
14	PDB:5eiyB	0.081	0.136	5.965E-6	658	0.041	0.076	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
15	PDB:7ufgA	0.078	0.082	1.315E-5	1151	0.058	0.061	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
16	PDB:4uflA	0.093	0.166	1.859E-5	641	0.031	0.059	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
17	PDB:7kveB	0.091	0.083	4.306E-5	1374	0.042	0.037	7kveB.pdb.gz
18	PDB:1uijC	0.060	0.151	4.753E-5	346	0.031	0.110	1uijC.pdb.gz
19	PDB:2e31A	0.101	0.401	4.753E-5	246	0.020	0.098	2e31A.pdb.gz
20	PDB:5wpwA	0.060	0.147	5.247E-5	379	0.037	0.119	5wpwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63191	0.0	1747	1216	0.725	0.725	AEGP_RAT Apical endosomal glycoprotein OS=Rattus norvegicus OX=10116 GN=Mamdc4 PE=1 SV=1
2	Q5VYJ5	7.33e-91	325	2156	0.262	0.147	MALR1_HUMAN MAM and LDL-receptor class A domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MALRD1 PE=1 SV=4
3	A2AJX4	2.97e-89	320	2123	0.265	0.152	MALR1_MOUSE MAM and LDL-receptor class A domain-containing protein 1 OS=Mus musculus OX=10090 GN=Malrd1 PE=1 SV=2
4	U5GXS0	6.08e-61	231	1486	0.169	0.139	U5GXS0_HUMAN MAM and LDL receptor class A domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MALRD1 PE=1 SV=1
5	Q7Z304	4.78e-34	142	686	0.139	0.246	MAMC2_HUMAN MAM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAMDC2 PE=1 SV=3
6	Q8CG85	5.50e-32	136	686	0.138	0.245	MAMC2_MOUSE MAM domain-containing protein 2 OS=Mus musculus OX=10090 GN=Mamdc2 PE=1 SV=1
7	O88799	8.78e-23	108	5376	0.117	0.026	ZAN_MOUSE Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV=1
8	Q7Z553	7.22e-18	92.0	956	0.047	0.060	MDGA2_HUMAN MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Homo sapiens OX=9606 GN=MDGA2 PE=1 SV=2
9	P60756	2.55e-17	90.1	949	0.043	0.055	MDGA2_RAT MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Rattus norvegicus OX=10116 GN=Mdga2 PE=2 SV=1
10	Q8NFP4	3.83e-17	89.7	955	0.044	0.055	MDGA1_HUMAN MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Homo sapiens OX=9606 GN=MDGA1 PE=1 SV=1
11	A0A3B3IU48	4.52e-17	89.4	973	0.044	0.054	A0A3B3IU48_HUMAN MAM domain containing glycosylphosphatidylinositol anchor 1 OS=Homo sapiens OX=9606 GN=MDGA1 PE=1 SV=1
12	P60755	4.96e-17	89.4	949	0.043	0.055	MDGA2_MOUSE MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Mus musculus OX=10090 GN=Mdga2 PE=1 SV=1
13	Q0WYX8	5.27e-17	89.4	949	0.046	0.059	MDGA1_CHICK MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Gallus gallus OX=9031 GN=MDGA1 PE=1 SV=1
14	Q0PMG2	5.91e-17	89.0	956	0.043	0.054	MDGA1_MOUSE MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Mus musculus OX=10090 GN=Mdga1 PE=2 SV=3
15	P85171	6.07e-17	89.0	956	0.043	0.054	MDGA1_RAT MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Rattus norvegicus OX=10116 GN=Mdga1 PE=1 SV=1
16	P98072	1.71e-15	84.3	1035	0.074	0.087	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
17	P98073	1.81e-15	84.3	1019	0.037	0.044	ENTK_HUMAN Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3
18	Q8QFX6	3.69e-15	83.2	923	0.052	0.068	NRP1A_DANRE Neuropilin-1a OS=Danio rerio OX=7955 GN=nrp1a PE=2 SV=1
19	P79795	2.32e-12	73.9	914	0.040	0.054	NRP1_CHICK Neuropilin-1 OS=Gallus gallus OX=9031 GN=NRP1 PE=2 SV=1
20	P97333	2.79e-12	73.9	923	0.044	0.057	NRP1_MOUSE Neuropilin-1 OS=Mus musculus OX=10090 GN=Nrp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00057 Ldl_recept_a	1.2e-05	36.7	Low-density lipoprotein receptor domain class A
2	PF00629 MAM	4.6e-196	655.7	MAM domain, meprin/A5/mu

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000010489

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000023996	0.635	Hepatocyte growth factor (hepapoietin A
2	61853.ENSNLEP00000008372	0.605	Macrophage stimulating 1 (hepatocyte growth factor-like)
3	61853.ENSNLEP00000001019	0.554	Growth factor receptor-bound protein 2
4	61853.ENSNLEP00000015961	0.554	annotation not available
5	61853.ENSNLEP00000018571	0.554	GRB2-related adaptor protein 2
6	61853.ENSNLEP00000020909	0.554	Inositol polyphosphate phosphatase-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.976	biological regulation
GO:0009987	0.833	cellular process
GO:0050789	0.800	regulation of biological process
GO:0050794	0.564	regulation of cellular process
GO:0048856	0.496	anatomical structure development
GO:0032501	0.436	multicellular organismal process
GO:0048513	0.391	animal organ development
GO:0008152	0.361	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031982	0.995	vesicle
GO:0031410	0.985	cytoplasmic vesicle
GO:0005768	0.763	endosome
GO:0071944	0.668	cell periphery
GO:0005576	0.618	extracellular region
GO:0016020	0.455	membrane
GO:0005615	0.408	extracellular space
GO:0005886	0.363	plasma membrane
GO:0070013	0.358	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]