StarFunc result for job id Q6UXF1

User Input

>input (575 residues)
MKRSLQALYCQLLSFLLILALTEALAFAIQEPSPRESLQVLPSGTPPGTMVTAPHSSTRH
TSVVMLTPNPDGPPSQAAAPMATPTPRAEGHPPTHTISTIAATVTAPHSESSLSTGPAPA
AMATTSSKPEGRPRGQAAPTILLTKPPGATSRPTTAPPRTTTRRPPRPPGSSRKGAGNSS
RPVPPAPGGHSRSKEGQRGRNPSSTPLGQKRPLGKIFQIYKGNFTGSVEPEPSTLTPRTP
LWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGLRRAAQGGGSTFTSQGGTPDA
TAASGAPVSPQAAPVPSQRPHHGDPQDGPSHSDSWLTVTPGTSRPLSTSSGVFTAATGPT
PAAFDTSVSAPSQGIPQGASTTPQAPTHPSRVSESTISGAKEETVATLTMTDRVPSPLST
VVSTATGNFLNRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI
SSCSVLLTVCCMKRKKKTANPENNLSYWNNTITMDYFNRHAVELPREIQSLETSEDQLSE
PRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXF1	0.999	0.999	4.393E-76	575	1.000	1.000	Q6UXF1.pdb.gz	TM108_HUMAN Transmembrane protein 108 OS=Homo sapiens OX=9606 GN=TMEM108 PE=1 SV=2
2	AFDB:Q8BHE4	0.275	0.276	3.606E-56	574	0.769	0.770	Q8BHE4.pdb.gz	TM108_MOUSE Transmembrane protein 108 OS=Mus musculus OX=10090 GN=Tmem108 PE=1 SV=1
3	AFDB:Q5TC82	0.087	0.048	1.347E-3	1133	0.184	0.094	Q5TC82.pdb.gz	RC3H1_HUMAN Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1
4	AFDB:M9PB92	0.057	0.036	2.232E-3	1062	0.148	0.080	M9PB92.pdb.gz	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
5	AFDB:Q93073	0.087	0.051	2.232E-3	1101	0.132	0.069	Q93073.pdb.gz	SBP2L_HUMAN Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L PE=1 SV=3
6	AFDB:Q9UPX6	0.077	0.054	6.124E-3	916	0.148	0.093	Q9UPX6.pdb.gz	MNAR1_HUMAN Major intrinsically disordered Notch2-binding receptor 1 OS=Homo sapiens OX=9606 GN=MINAR1 PE=1 SV=3
7	AFDB:Q385M7	0.066	0.060	6.581E-3	650	0.153	0.135	Q385M7.pdb.gz	Q385M7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3080 PE=4 SV=1
8	AFDB:P39083	0.080	0.057	1.680E-2	1007	0.141	0.080	P39083.pdb.gz	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1
9	AFDB:Q3LHL9	0.064	0.029	3.215E-2	1658	0.191	0.066	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
10	AFDB:D3Z8E6	0.084	0.038	3.991E-2	1604	0.163	0.059	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
11	PDB:4v6wCE	0.038	0.080	6.659	228	0.023	0.057	4v6wCE.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:7v2wJ	0.061	0.135	6.659	236	0.026	0.064	7v2wJ.pdb.gz
13	PDB:6sgaF7	0.042	0.037	7.157	662	0.028	0.024	6sgaF7.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
14	PDB:7dvqR	0.080	0.151	8.267	241	0.040	0.095	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXF1	0.0	1146	575	1.000	1.000	TM108_HUMAN Transmembrane protein 108 OS=Homo sapiens OX=9606 GN=TMEM108 PE=1 SV=2
2	Q8BHE4	0.0	774	574	0.765	0.767	TM108_MOUSE Transmembrane protein 108 OS=Mus musculus OX=10090 GN=Tmem108 PE=1 SV=1
3	A1Z9I8	8.11e-05	48.5	5385	0.087	0.009	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
4	B7YZG2	8.11e-05	48.5	5370	0.087	0.009	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
5	A1Z9I9	9.21e-05	48.1	5390	0.087	0.009	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
6	B7YZG3	9.21e-05	48.1	5375	0.087	0.009	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
7	A1Z9J0	1.08e-04	48.1	5201	0.087	0.010	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
8	Q7KJN8	1.08e-04	48.1	5201	0.087	0.010	Q7KJN8_DROME Short stop/Kakapo long isoform OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
9	O96936	1.33e-04	47.8	4151	0.087	0.012	O96936_DROME Kakapo (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
10	A1Z9J1	1.45e-04	47.4	5501	0.087	0.009	A1Z9J1_DROME Short stop, isoform A OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	B7YZG5	1.45e-04	47.4	5486	0.087	0.009	B7YZG5_DROME Short stop, isoform L OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
12	E1JH64	1.57e-04	47.4	5155	0.087	0.010	E1JH64_DROME Short stop, isoform Q OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	A1Z9J2	1.71e-04	47.4	5160	0.087	0.010	A1Z9J2_DROME Short stop, isoform C OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	B7YZG4	7.66e-04	45.1	5368	0.099	0.011	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	A0A0B4K7P8	7.99e-04	45.1	5394	0.099	0.011	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	E1JH62	8.06e-04	45.1	5388	0.099	0.011	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	A0A0B4K7Y9	8.92e-04	45.1	5408	0.099	0.011	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	B7YZG6	0.001	44.3	5479	0.099	0.010	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	E1JH63	0.001	44.3	5499	0.099	0.010	E1JH63_DROME Short stop, isoform O OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	A0A0B4K718	0.002	43.9	4100	0.099	0.014	A0A0B4K718_DROME Short stop, isoform AB OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15759 TMEM108	7.7e-273	917.7	TMEM108 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369981	0.839	Endophilin-A1
2	9606.ENSP00000348965	0.720	Cytoplasmic dynein 1 heavy chain 1
3	9606.ENSP00000356917	0.714	Olfactomedin-like protein 2B
4	9606.ENSP00000307959	0.652	Dystonin
5	9606.ENSP00000401145	0.612	Growth arrest-specific protein 2
6	9606.ENSP00000403067	0.599	FERM domain-containing protein 5
7	9606.ENSP00000254627	0.564	Otoconin 90
8	9606.ENSP00000262283	0.564	Otoconin-90
9	9606.ENSP00000331474	0.548	Synapse differentiation-inducing gene protein 1-like
10	9606.ENSP00000355510	0.539	WD repeat-containing protein 64
11	9606.ENSP00000389870	0.538	Homeobox protein DLX-3
12	9606.ENSP00000354791	0.536	Dynactin subunit 1
13	9606.ENSP00000410396	0.529	Protein CMSS1
14	9606.ENSP00000358309	0.517	Ephrin type-A receptor 7
15	9606.ENSP00000378650	0.516	T-box transcription factor TBX6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0048518	0.951	positive regulation of biological process
GO:0016043	0.942	cellular component organization
GO:0050896	0.930	response to stimulus
GO:0048522	0.923	positive regulation of cellular process
GO:0048856	0.918	anatomical structure development
GO:0023051	0.877	regulation of signaling
GO:0032501	0.867	multicellular organismal process
GO:0010646	0.830	regulation of cell communication
GO:0007275	0.738	multicellular organism development
GO:0048731	0.685	system development
GO:0051179	0.631	localization
GO:0009653	0.512	anatomical structure morphogenesis
GO:0048583	0.497	regulation of response to stimulus
GO:0065008	0.494	regulation of biological quality
GO:0051641	0.480	cellular localization
GO:0007399	0.457	nervous system development
GO:0051234	0.449	establishment of localization
GO:0048869	0.415	cellular developmental process
GO:0120036	0.415	plasma membrane bounded cell projection organization
GO:0030154	0.414	cell differentiation
GO:0048468	0.370	cell development
GO:0007017	0.369	microtubule-based process
GO:0006810	0.367	transport
GO:0019222	0.340	regulation of metabolic process
GO:0006996	0.311	organelle organization
GO:0060255	0.303	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.999	endomembrane system
GO:0120025	0.996	plasma membrane bounded cell projection
GO:0031410	0.996	cytoplasmic vesicle
GO:0030659	0.991	cytoplasmic vesicle membrane
GO:0030424	0.990	axon
GO:0005768	0.990	endosome
GO:0030054	0.989	cell junction
GO:0098588	0.989	bounding membrane of organelle
GO:0036477	0.987	somatodendritic compartment
GO:0098984	0.981	neuron to neuron synapse
GO:0010008	0.968	endosome membrane
GO:0099572	0.966	postsynaptic specialization
GO:0005769	0.966	early endosome
GO:0014069	0.964	postsynaptic density
GO:0071944	0.926	cell periphery
GO:0005886	0.912	plasma membrane
GO:0005829	0.529	cytosol
GO:0009897	0.394	external side of plasma membrane
GO:0097447	0.349	dendritic tree

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]