StarFunc result for job id Q6UXG2

User Input

>input (1013 residues)
MAEPGHSHHLSARVRGRTERRIPRLWRLLLWAGTAFQVTQGTGPELHACKESEYHYEYTA
CDSTGSRWRVAVPHTPGLCTSLPDPIKGTECSFSCNAGEFLDMKDQSCKPCAEGRYSLGT
GIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKWVPRGDYIASNTDECTATLMYA
VNLKQSGTVNFEYYYPDSSIIFEFFVQNDQCQPNADDSRWMKTTEKGWEFHSVELNRGNN
VLYWRTTAFSVWTKVPKPVLVRNIAITGVAYTSECFPCKPGTYADKQGSSFCKLCPANSY
SNKGETSCHQCDPDKYSEKGSSSCNVRPACTDKDYFYTHTACDANGETQLMYKWAKPKIC
SEDLEGAVKLPASGVKTHCPPCNPGFFKTNNSTCQPCPYGSYSNGSDCTRCPAGTEPAVG
FEYKWWNTLPTNMETTVLSGINFEYKGMTGWEVAGDHIYTAAGASDNDFMILTLVVPGFR
PPQSVMADTENKEVARITFVFETLCSVNCELYFMVGVNSRTNTPVETWKGSKGKQSYTYI
IEENTTTSFTWAFQRTTFHEASRKYTNDVAKIYSINVTNVMNGVASYCRPCALEASDVGS
SCTSCPAGYYIDRDSGTCHSCPTNTILKAHQPYGVQACVPCGPGTKNNKIHSLCYNDCTF
SRNTPTRTFNYNFSALANTVTLAGGPSFTSKGLKYFHHFTLSLCGNQGRKMSVCTDNVTD
LRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVTTDMTLDGITS
PAELFHLESLGIPDVIFFYRSNDVTQSCSSGRSTTIRVRCSPQKTVPGSLLLPGTCSDGT
CDGCNFHFLWESAAACPLCSVADYHAIVSSCVAGIQKTTYVWREPKLCSGGISLPEQRVT
ICKTIDFWLKVGISAGTCTAILLTVLTCYFWKKNQKLEYKYSKLVMNATLKDCDLPAADS
CAIMEGEDVEDDLIFTSKKSLFGKIKSFTSKRTPDGFDSVPLKTSSGGLDMDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PB18	0.608	0.682	0.000	901	0.889	1.000	E9PB18.pdb.gz	E9PB18_HUMAN Endosome-lysosome associated apoptosis and autophagy regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=1
2	AFDB:Q3UZV7	0.802	0.791	0.000	1028	0.526	0.518	Q3UZV7.pdb.gz	ELAP2_MOUSE Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 OS=Mus musculus OX=10090 GN=Elapor2 PE=1 SV=1
3	AFDB:Q6DDW2	0.661	0.671	0.000	995	0.523	0.533	Q6DDW2.pdb.gz	ELAP2_XENLA Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 OS=Xenopus laevis OX=8355 GN=elapor2 PE=1 SV=2
4	AFDB:Q6UXG2	1.000	1.000	0.000	1013	1.000	1.000	Q6UXG2.pdb.gz	ELAP1_HUMAN Endosome/lysosome-associated apoptosis and autophagy regulator 1 OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=2
5	AFDB:P42702	0.081	0.078	2.529E-8	1097	0.126	0.117	P42702.pdb.gz	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
6	PDB:5eiyB	0.085	0.121	2.798E-6	658	0.042	0.065	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
7	AFDB:F1LXJ9	0.091	0.074	1.629E-5	1269	0.085	0.068	F1LXJ9.pdb.gz	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
8	PDB:8a7eC	0.099	0.073	3.582E-5	1524	0.096	0.064	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
9	PDB:7ufgA	0.105	0.094	1.061E-4	1151	0.055	0.049	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
10	PDB:2vqaA	0.057	0.124	1.548E-4	356	0.037	0.104	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
11	AFDB:F1NY98	0.054	0.034	1.571E-4	2034	0.093	0.046	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
12	PDB:6vlsD	0.084	0.087	2.054E-4	963	0.040	0.043	6vlsD.pdb.gz
13	AFDB:F1QUB9	0.055	0.053	2.402E-4	1065	0.096	0.091	F1QUB9.pdb.gz
14	PDB:1fxzA	0.056	0.107	2.481E-4	371	0.038	0.105	1fxzA.pdb.gz
15	PDB:6l4cB	0.064	0.137	3.294E-4	373	0.037	0.099	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
16	PDB:4ziqA	0.067	0.051	3.620E-4	1450	0.072	0.050	4ziqA.pdb.gz
17	PDB:2e31A	0.100	0.345	5.804E-4	246	0.027	0.110	2e31A.pdb.gz
18	PDB:4h2aA	0.070	0.093	5.804E-4	704	0.079	0.114	4h2aA.pdb.gz	Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
19	AFDB:O70394	0.092	0.131	2.010E-3	623	0.070	0.114	O70394.pdb.gz	I27RA_MOUSE Interleukin-27 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il27ra PE=1 SV=2
20	AFDB:Q9VWA7	0.112	0.095	2.107E-3	1272	0.081	0.064	Q9VWA7.pdb.gz	Q9VWA7_DROME Golden goal OS=Drosophila melanogaster OX=7227 GN=gogo PE=2 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PB18	0.0	1857	901	0.889	1.000	E9PB18_HUMAN Endosome-lysosome associated apoptosis and autophagy regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=1
2	Q3UZV7	0.0	1142	1028	0.525	0.518	ELAP2_MOUSE Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 OS=Mus musculus OX=10090 GN=Elapor2 PE=1 SV=1
3	Q6DDW2	0.0	1122	995	0.530	0.540	ELAP2_XENLA Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 OS=Xenopus laevis OX=8355 GN=elapor2 PE=1 SV=2
4	Q6UXG2	0.0	2111	1013	1.000	1.000	ELAP1_HUMAN Endosome/lysosome-associated apoptosis and autophagy regulator 1 OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=2
5	E9PLQ2	4.26e-146	435	205	0.202	1.000	E9PLQ2_HUMAN Endosome-lysosome associated apoptosis and autophagy regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=ELAPOR1 PE=1 SV=1
6	E1JHA6	0.001	45.4	3589	0.031	0.009	E1JHA6_DROME Uninflatable, isoform C OS=Drosophila melanogaster OX=7227 GN=uif PE=1 SV=1
7	Q9VM55	0.001	45.4	3557	0.031	0.009	Q9VM55_DROME Uninflatable, isoform B OS=Drosophila melanogaster OX=7227 GN=uif PE=1 SV=3
8	Q4LDE5	0.003	44.3	3571	0.044	0.013	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
9	P54753	0.005	43.5	998	0.028	0.028	EPHB3_HUMAN Ephrin type-B receptor 3 OS=Homo sapiens OX=9606 GN=EPHB3 PE=1 SV=2
10	A2AVA0	0.016	42.0	3567	0.047	0.013	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
11	Q5G872	0.026	41.2	1010	0.050	0.050	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
12	P54754	0.044	40.4	993	0.027	0.027	EPHB3_MOUSE Ephrin type-B receptor 3 OS=Mus musculus OX=10090 GN=Ephb3 PE=1 SV=2
13	Q66PY1	0.10	38.9	993	0.044	0.045	SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1
14	Q8IX30	0.21	38.1	993	0.042	0.043	SCUB3_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCUBE3 PE=1 SV=1
15	Q9Z0R7	0.29	37.7	843	0.016	0.019	TS1R2_RAT Taste receptor type 1 member 2 OS=Rattus norvegicus OX=10116 GN=Tas1r2 PE=2 SV=1
16	O61460	0.42	37.0	1122	0.021	0.019	VAB1_CAEEL Ephrin receptor 1 OS=Caenorhabditis elegans OX=6239 GN=vab-1 PE=1 SV=1
17	A0A8I6AHI1	0.43	36.6	309	0.039	0.129	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
18	F6SVZ3	0.58	35.8	269	0.016	0.059	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
19	A0A8I6A4J5	0.62	35.8	260	0.039	0.154	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
20	A0A8I5XVD8	0.74	35.0	204	0.042	0.211	A0A8I5XVD8_RAT CD40 molecule OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07699 Ephrin_rec_like	0.013	26.6	Tyrosine-protein kinase ephrin type A/B receptor-like
2	PF07562 NCD3G	0.023	25.9	Nine Cysteines Domain of family 3 GPCR

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358955

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262903	0.934	E3 ubiquitin-protein ligase HACE1
2	9606.ENSP00000433361	0.568	Transmembrane protein 9B
3	9606.ENSP00000479976	0.506	Uncharacterized protein C11orf96
4	9606.ENSP00000246080	0.501	Transcription factor 15
5	9606.ENSP00000328524	0.501	DENN domain-containing protein 5A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003824	0.373	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0019222	0.974	regulation of metabolic process
GO:0031323	0.960	regulation of cellular metabolic process
GO:0048522	0.950	positive regulation of cellular process
GO:0071840	0.925	cellular component organization or biogenesis
GO:0016043	0.923	cellular component organization
GO:0009056	0.917	catabolic process
GO:0044237	0.913	cellular metabolic process
GO:0050896	0.905	response to stimulus
GO:1905037	0.864	autophagosome organization
GO:0044088	0.863	regulation of vacuole organization
GO:0016241	0.863	regulation of macroautophagy
GO:0071496	0.852	cellular response to external stimulus
GO:0007154	0.841	cell communication
GO:0009991	0.841	response to extracellular stimulus
GO:0051716	0.835	cellular response to stimulus
GO:0009893	0.828	positive regulation of metabolic process
GO:0031669	0.726	cellular response to nutrient levels
GO:1902115	0.693	regulation of organelle assembly
GO:0016239	0.693	positive regulation of macroautophagy
GO:0009267	0.686	cellular response to starvation
GO:0051130	0.667	positive regulation of cellular component organization
GO:0044089	0.660	positive regulation of cellular component biogenesis
GO:0010638	0.660	positive regulation of organelle organization
GO:0000045	0.642	autophagosome assembly
GO:1902117	0.641	positive regulation of organelle assembly
GO:2000785	0.615	regulation of autophagosome assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.918	intracellular anatomical structure
GO:0043226	0.912	organelle
GO:0005737	0.822	cytoplasm
GO:0043231	0.818	intracellular membrane-bounded organelle
GO:0012505	0.773	endomembrane system
GO:0005576	0.646	extracellular region
GO:0070013	0.431	intracellular organelle lumen
GO:0031982	0.412	vesicle
GO:0031981	0.367	nuclear lumen
GO:0005654	0.327	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]