StarFunc result for job id Q6UXH8

User Input

>input (406 residues)
MVPPPPSRGGAARGQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSESKIATTKYPCL
KSSGELTTCYRKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYD
RERHRKREKPYCLDIDECASSNGTLCAHICINTLGSYRCECREGYIREDDGKTCTRGDKY
PNDTGHEKSENMVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLA
SNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQG
RRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHR
THSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3MI99	0.508	0.506	5.992E-56	408	0.901	0.897	Q3MI99.pdb.gz	CCBE1_MOUSE Collagen and calcium-binding EGF domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ccbe1 PE=2 SV=2
2	AFDB:Q6ZUT6	0.056	0.045	9.102E-2	534	0.148	0.112	Q6ZUT6.pdb.gz	CCD9B_HUMAN Coiled-coil domain-containing protein 9B OS=Homo sapiens OX=9606 GN=CCDC9B PE=1 SV=1
3	PDB:4bxsA	0.103	0.166	1.245E-1	248	0.037	0.060	4bxsA.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
4	AFDB:Q9TY99	0.093	0.065	4.440E-1	654	0.135	0.084	Q9TY99.pdb.gz	Q9TY99_PLAF7 Knob-associated histidine-rich protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0202000 PE=4 SV=1
5	AFDB:Q03043	0.058	0.030	5.330E-1	1088	0.190	0.071	Q03043.pdb.gz	KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster OX=7227 GN=for PE=1 SV=3
6	AFDB:Q04429	0.073	0.071	6.021E-1	423	0.143	0.137	Q04429.pdb.gz	HLR1_YEAST Protein HLR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HLR1 PE=1 SV=1
7	AFDB:C8VAX8	0.080	0.057	7.229E-1	615	0.138	0.091	C8VAX8.pdb.gz	C8VAX8_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04698 PE=4 SV=1
8	AFDB:H2KZ82	0.073	0.043	7.229E-1	806	0.140	0.071	H2KZ82.pdb.gz	H2KZ82_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pqn-21 PE=1 SV=1
9	AFDB:Q8T076	0.076	0.037	1.042	1066	0.118	0.045	Q8T076.pdb.gz	Q8T076_DROME LD22513p OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
10	PDB:3s3zA	0.071	0.165	1.117	105	0.032	0.124	3s3zA.pdb.gz
11	PDB:4bxwB	0.082	0.115	1.341	287	0.030	0.042	4bxwB.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
12	AFDB:Q9Y7J9	0.083	0.040	1.413	968	0.135	0.057	Q9Y7J9.pdb.gz	MCP5_SCHPO Meiotic coiled-coil protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcp5 PE=1 SV=1
13	AFDB:Q9ULI3	0.141	0.056	1.502	1381	0.158	0.046	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
14	PDB:6w6eI	0.058	0.065	1.711	357	0.007	0.008	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
15	PDB:7ksrC	0.058	0.059	1.711	397	0.069	0.071	7ksrC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
16	PDB:6h25J	0.050	0.024	1.819	868	0.005	0.002	6h25J.pdb.gz	Distinct and evolutionary conserved structural features of the human nuclear exosome complex.
17	PDB:7kgbS	0.044	0.144	2.055	113	0.010	0.035	7kgbS.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
18	PDB:7un6B	0.063	0.101	2.467	240	0.012	0.021	7un6B.pdb.gz
19	PDB:1h0xA	0.043	0.180	2.622	89	0.012	0.056	1h0xA.pdb.gz
20	PDB:3j6bS	0.064	0.144	2.787	146	0.032	0.089	3j6bS.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3MI99	0.0	583	408	0.901	0.897	CCBE1_MOUSE Collagen and calcium-binding EGF domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ccbe1 PE=2 SV=2
2	Q6UXH8	0.0	820	406	1.000	1.000	CCBE1_HUMAN Collagen and calcium-binding EGF domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CCBE1 PE=1 SV=1
3	A8WGB1	1.49e-146	423	401	0.635	0.643	CCBE1_DANRE Collagen and calcium-binding EGF domain-containing protein 1 OS=Danio rerio OX=7955 GN=ccbe1 PE=1 SV=2
4	A8TX70	5.73e-14	76.6	2615	0.111	0.017	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
5	F1R0I7	1.35e-13	75.1	995	0.123	0.050	F1R0I7_DANRE Scube3 OS=Danio rerio OX=7955 GN=scube3 PE=2 SV=3
6	E9PWQ3	1.54e-13	75.1	3284	0.111	0.014	E9PWQ3_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
7	A0A8I6AHL9	4.81e-13	73.6	3316	0.113	0.014	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
8	O89103	5.36e-13	72.8	644	0.106	0.067	C1QR1_MOUSE Complement component C1q receptor OS=Mus musculus OX=10090 GN=Cd93 PE=1 SV=1
9	A0A8I5ZTR6	6.82e-13	73.2	3109	0.113	0.015	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
10	P12111	2.58e-12	71.2	3177	0.103	0.013	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
11	A6NMZ7	3.02e-12	71.2	2263	0.099	0.018	CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2
12	O00339	8.11e-12	69.3	956	0.116	0.049	MATN2_HUMAN Matrilin-2 OS=Homo sapiens OX=9606 GN=MATN2 PE=1 SV=4
13	F1SPG5	1.16e-11	68.9	1221	0.099	0.033	F1SPG5_PIG Fibulin 2 OS=Sus scrofa OX=9823 GN=FBLN2 PE=1 SV=3
14	O08746	2.82e-11	67.8	956	0.113	0.048	MATN2_MOUSE Matrilin-2 OS=Mus musculus OX=10090 GN=Matn2 PE=2 SV=2
15	E0AE56	4.36e-11	67.4	4673	0.084	0.007	E0AE56_DANRE Low-density lipoprotein receptor-related protein 2 OS=Danio rerio OX=7955 GN=lrp2 PE=1 SV=1
16	Q5G872	6.36e-11	66.6	1010	0.099	0.040	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
17	P98095	6.88e-11	66.6	1184	0.094	0.032	FBLN2_HUMAN Fibulin-2 OS=Homo sapiens OX=9606 GN=FBLN2 PE=1 SV=2
18	Q8IX30	7.35e-11	66.6	993	0.128	0.052	SCUB3_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCUBE3 PE=1 SV=1
19	P98158	7.73e-11	66.6	4660	0.086	0.008	LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Lrp2 PE=1 SV=1
20	Q9UBX5	7.77e-11	65.9	448	0.118	0.107	FBLN5_HUMAN Fibulin-5 OS=Homo sapiens OX=9606 GN=FBLN5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	3.2e-06	38.2	Complement Clr-like EGF-like
2	PF01391 Collagen	8.8e-10	49.5	Collagen triple helix repeat (20 copies)
3	PF00008 EGF	0.015	26.8	EGF-like domain
4	PF07645 EGF_CA	5.1e-06	37.9	Calcium-binding EGF domain
5	PF14670 FXa_inhibition	0.00016	33.2	Coagulation Factor Xa inhibitory site
6	PF12661 hEGF	19	17.3	Human growth factor-like EGF
7	PF09064 Tme5_EGF_like	66	14.8	Thrombomodulin like fifth domain, EGF-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480043	0.898	Vascular endothelial growth factor C
2	9606.ENSP00000286657	0.868	A disintegrin and metalloproteinase with thrombospondin motifs 3
3	9606.ENSP00000261937	0.864	Vascular endothelial growth factor receptor 3
4	9606.ENSP00000341815	0.803	Transcription factor SOX-18
5	9606.ENSP00000297904	0.755	Vascular endothelial growth factor D
6	9606.ENSP00000256178	0.754	Lymphatic vessel endothelial hyaluronic acid receptor 1
7	9606.ENSP00000251582	0.697	A disintegrin and metalloproteinase with thrombospondin motifs 2
8	9606.ENSP00000290431	0.686	Polycystic kidney disease 2-like 2 protein
9	9606.ENSP00000373979	0.680	Trafficking protein particle complex subunit 9
10	9606.ENSP00000255681	0.679	O-acetyl-ADP-ribose deacetylase MACROD1
11	9606.ENSP00000344254	0.676	FXYD domain-containing ion transport regulator 5
12	9606.ENSP00000355675	0.637	Gap junction gamma-2 protein
13	9606.ENSP00000354607	0.632	Frizzled-5
14	9606.ENSP00000361800	0.605	WD repeat-containing protein 34
15	9606.ENSP00000264741	0.599	Integrin alpha-9
16	9606.ENSP00000216252	0.593	PHD finger-like domain-containing protein 5A
17	9606.ENSP00000326371	0.576	Forkhead box protein C2
18	9606.ENSP00000215057	0.560	Myeloid zinc finger 1
19	9606.ENSP00000355925	0.555	Prospero homeobox protein 1
20	9606.ENSP00000438284	0.554	cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.996	enzyme binding
GO:0005518	0.991	collagen binding
GO:0002020	0.989	protease binding
GO:0042802	0.371	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.977	cellular process
GO:0032501	0.964	multicellular organismal process
GO:0048856	0.963	anatomical structure development
GO:0048518	0.943	positive regulation of biological process
GO:0007275	0.939	multicellular organism development
GO:0048522	0.922	positive regulation of cellular process
GO:0001946	0.898	lymphangiogenesis
GO:0009893	0.840	positive regulation of metabolic process
GO:0010468	0.823	regulation of gene expression
GO:0051246	0.813	regulation of protein metabolic process
GO:0010604	0.810	positive regulation of macromolecule metabolic process
GO:0010628	0.757	positive regulation of gene expression
GO:0051239	0.754	regulation of multicellular organismal process
GO:0048583	0.737	regulation of response to stimulus
GO:0090287	0.713	regulation of cellular response to growth factor stimulus
GO:0048584	0.705	positive regulation of response to stimulus
GO:0009967	0.688	positive regulation of signal transduction
GO:1903317	0.679	regulation of protein maturation
GO:0051240	0.602	positive regulation of multicellular organismal process
GO:0030335	0.565	positive regulation of cell migration
GO:0050896	0.494	response to stimulus
GO:0051173	0.430	positive regulation of nitrogen compound metabolic process
GO:0051716	0.362	cellular response to stimulus
GO:0007154	0.355	cell communication
GO:0030162	0.349	regulation of proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005576	0.997	extracellular region
GO:0005615	0.978	extracellular space
GO:0031012	0.963	extracellular matrix
GO:0005622	0.777	intracellular anatomical structure
GO:0043226	0.769	organelle
GO:0043227	0.763	membrane-bounded organelle
GO:0043231	0.727	intracellular membrane-bounded organelle
GO:0062023	0.570	collagen-containing extracellular matrix
GO:0016020	0.500	membrane
GO:0005737	0.477	cytoplasm
GO:0005886	0.366	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]