StarFunc result for job id Q6UXI9

User Input

>input (565 residues)
MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYM
LMPDGSCSSALTCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVDVDECATGRASC
PRFRQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNIRGSYKC
KCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTP
YIPPIITNRPTSKPTTRPTPKPTPIPTPPPPPPLPTELRTPLPPTTPERPTTGLTTIAPA
ASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVH
SCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSGD
LCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGHGWRQTQITLRGADIKSVVFKGE
KRRGHTGEIGLDDVSLKKGHCSEER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXI9	1.000	1.000	3.060E-102	565	1.000	1.000	Q6UXI9.pdb.gz	NPNT_HUMAN Nephronectin OS=Homo sapiens OX=9606 GN=NPNT PE=2 SV=3
2	AFDB:Q91V88	0.294	0.296	3.215E-86	561	0.874	0.881	Q91V88.pdb.gz	NPNT_MOUSE Nephronectin OS=Mus musculus OX=10090 GN=Npnt PE=1 SV=1
3	AFDB:Q6DHG1	0.262	0.290	2.474E-51	508	0.396	0.441	Q6DHG1.pdb.gz	Q6DHG1_DANRE EGF-like-domain, multiple 6 OS=Danio rerio OX=7955 GN=sb:cb3 PE=2 SV=1
4	AFDB:Q9JJZ5	0.266	0.273	3.784E-47	550	0.375	0.385	Q9JJZ5.pdb.gz	EGFL6_MOUSE Epidermal growth factor-like protein 6 OS=Mus musculus OX=10090 GN=Egfl6 PE=1 SV=1
5	AFDB:Q8IUX8	0.252	0.257	8.748E-46	553	0.366	0.374	Q8IUX8.pdb.gz	EGFL6_HUMAN Epidermal growth factor-like protein 6 OS=Homo sapiens OX=9606 GN=EGFL6 PE=1 SV=1
6	AFDB:A0A1F4	0.129	0.047	1.292E-7	2176	0.158	0.041	A0A1F4.pdb.gz	EYS_DROME Protein eyes shut OS=Drosophila melanogaster OX=7227 GN=eys PE=1 SV=1
7	PDB:7q3nU	0.135	0.229	1.818E-7	292	0.090	0.175	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
8	AFDB:Q91V98	0.101	0.077	6.378E-7	765	0.152	0.112	Q91V98.pdb.gz	CD248_MOUSE Endosialin OS=Mus musculus OX=10090 GN=Cd248 PE=1 SV=1
9	PDB:3wsoA	0.178	0.340	5.484E-6	252	0.034	0.075	3wsoA.pdb.gz
10	PDB:2e31A	0.172	0.336	1.356E-5	246	0.046	0.106	2e31A.pdb.gz
11	PDB:7ungXA	0.180	0.437	2.402E-4	186	0.044	0.134	7ungXA.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	AFDB:Q5DID3	0.078	0.036	3.792E-4	1319	0.096	0.041	Q5DID3.pdb.gz	UROL1_MOUSE Uromodulin-like 1 OS=Mus musculus OX=10090 GN=Umodl1 PE=1 SV=1
13	PDB:4fixA	0.137	0.125	4.798E-4	629	0.035	0.032	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
14	AFDB:Q7ZZT0	0.104	0.073	7.184E-4	911	0.152	0.094	Q7ZZT0.pdb.gz	Q7ZZT0_DANRE Low density lipoprotein receptor OS=Danio rerio OX=7955 GN=ldlr PE=4 SV=1
15	PDB:6ve73	0.185	0.450	8.171E-4	187	0.041	0.123	6ve73.pdb.gz	The inner junction complex of the cilia is an interaction hub that involves tubulin post-translational modifications.
16	PDB:5e7gA	0.188	0.231	8.618E-4	446	0.039	0.049	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
17	PDB:5vaeB	0.152	0.489	2.130E-3	134	0.023	0.097	5vaeB.pdb.gz
18	PDB:4tlgA	0.124	0.168	2.370E-3	396	0.027	0.038	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
19	PDB:7qe7L	0.143	0.361	2.636E-3	183	0.030	0.093	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
20	AFDB:Q9VHP9	0.077	0.041	2.867E-3	1411	0.129	0.052	Q9VHP9.pdb.gz	Q9VHP9_DROME Centromeric protein-C, isoform A OS=Drosophila melanogaster OX=7227 GN=Cenp-C PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8A5G4	0.0	606	605	0.586	0.547	B8A5G4_DANRE Nephronectin a OS=Danio rerio OX=7955 GN=POEM PE=3 SV=1
2	Q6UXI9	0.0	1161	565	1.000	1.000	NPNT_HUMAN Nephronectin OS=Homo sapiens OX=9606 GN=NPNT PE=2 SV=3
3	Q91V88	0.0	943	561	0.874	0.881	NPNT_MOUSE Nephronectin OS=Mus musculus OX=10090 GN=Npnt PE=1 SV=1
4	Q6DHG1	2.91e-139	415	508	0.407	0.453	Q6DHG1_DANRE EGF-like-domain, multiple 6 OS=Danio rerio OX=7955 GN=sb:cb3 PE=2 SV=1
5	Q9JJZ5	1.72e-129	391	550	0.381	0.391	EGFL6_MOUSE Epidermal growth factor-like protein 6 OS=Mus musculus OX=10090 GN=Egfl6 PE=1 SV=1
6	Q8IUX8	2.60e-128	388	553	0.375	0.383	EGFL6_HUMAN Epidermal growth factor-like protein 6 OS=Homo sapiens OX=9606 GN=EGFL6 PE=1 SV=1
7	P37889	6.03e-30	127	1221	0.136	0.063	FBLN2_MOUSE Fibulin-2 OS=Mus musculus OX=10090 GN=Fbln2 PE=1 SV=2
8	F1SPG5	3.48e-29	125	1221	0.131	0.061	F1SPG5_PIG Fibulin 2 OS=Sus scrofa OX=9823 GN=FBLN2 PE=1 SV=3
9	P35556	5.86e-29	125	2912	0.142	0.027	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
10	Q61555	1.42e-28	124	2907	0.140	0.027	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
11	P98095	6.22e-28	121	1184	0.129	0.062	FBLN2_HUMAN Fibulin-2 OS=Homo sapiens OX=9606 GN=FBLN2 PE=1 SV=2
12	A0A0G2KQ62	8.83e-27	118	2868	0.138	0.027	A0A0G2KQ62_DANRE Fibrillin 2b OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=2
13	B6CS38	9.15e-27	118	2868	0.138	0.027	B6CS38_DANRE Fibrillin 2 OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=1
14	O95967	1.86e-24	108	443	0.120	0.153	FBLN4_HUMAN EGF-containing fibulin-like extracellular matrix protein 2 OS=Homo sapiens OX=9606 GN=EFEMP2 PE=1 SV=3
15	P98133	4.75e-24	109	2871	0.136	0.027	FBN1_BOVIN Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2
16	P35555	1.64e-23	108	2871	0.135	0.026	FBN1_HUMAN Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4
17	Q9VS89	2.81e-23	107	1618	0.122	0.043	Q9VS89_DROME FI18763p1 OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=4
18	Q9WUH8	2.99e-23	107	2872	0.145	0.029	Q9WUH8_RAT Fibrillin-1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=2 SV=1
19	A0A8I6G7Y9	3.69e-23	107	2861	0.133	0.026	A0A8I6G7Y9_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
20	A0A8I6A897	4.06e-23	107	2813	0.133	0.027	A0A8I6A897_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	6e-18	75.7	Complement Clr-like EGF-like
2	PF00008 EGF	0.00023	32.7	EGF-like domain
3	PF07974 EGF_2	92	14.8	EGF-like domain
4	PF12947 EGF_3	3.8e-09	47.9	EGF domain
5	PF07645 EGF_CA	2.8e-19	80.4	Calcium-binding EGF domain
6	PF12946 EGF_MSP1_1	0.69	21.3	MSP1 EGF domain 1
7	PF14670 FXa_inhibition	3.7e-06	38.5	Coagulation Factor Xa inhibitory site
8	PF12661 hEGF	1.8e+02	14.2	Human growth factor-like EGF
9	PF00629 MAM	7.1e-20	82.9	MAM domain, meprin/A5/mu

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389252

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367316	0.997	Integrin alpha-8
2	9606.ENSP00000379350	0.958	Integrin beta-1
3	9606.ENSP00000412940	0.928	FRAS1-related extracellular matrix protein 1
4	9606.ENSP00000326330	0.921	Fraser extracellular matrix complex subunit 1
5	9606.ENSP00000280481	0.891	FRAS1-related extracellular matrix protein 2
6	9606.ENSP00000378888	0.690	Epidermal growth factor-like protein 8
7	9606.ENSP00000422354	0.684	Glutathione S-transferase C-terminal domain containing
8	9606.ENSP00000415433	0.681	Integrator complex subunit 12
9	9606.ENSP00000363040	0.645	Multiple epidermal growth factor-like domains protein 9
10	9606.ENSP00000428579	0.627	NACHT domain- and WD repeat-containing protein 1
11	9606.ENSP00000362222	0.604	Serine/threonine-protein kinase 40
12	9606.ENSP00000347484	0.573	Thrombospondin type-1 domain-containing protein 4
13	9606.ENSP00000254898	0.572	Matrilin-2
14	9606.ENSP00000274938	0.572	Signal peptide, CUB and EGF-like domain-containing protein 3
15	9606.ENSP00000264344	0.556	Protein FAM13A
16	9606.ENSP00000375907	0.556	PTB-containing, cubilin and LRP1-interacting protein
17	9606.ENSP00000376708	0.540	Von Willebrand factor A domain containing 2
18	9606.ENSP00000007722	0.528	Integrin alpha-3
19	9606.ENSP00000354608	0.517	Lysosomal thioesterase PPT2
20	9606.ENSP00000326531	0.514	THO complex subunit 6 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	1.000	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0032501	0.984	multicellular organismal process
GO:0050794	0.980	regulation of cellular process
GO:0032502	0.951	developmental process
GO:0048856	0.935	anatomical structure development
GO:0007275	0.927	multicellular organism development
GO:0009653	0.889	anatomical structure morphogenesis
GO:0048513	0.865	animal organ development
GO:0048731	0.849	system development
GO:0050896	0.833	response to stimulus
GO:0007155	0.818	cell adhesion
GO:0010646	0.787	regulation of cell communication
GO:0009887	0.775	animal organ morphogenesis
GO:0048583	0.772	regulation of response to stimulus
GO:0023051	0.754	regulation of signaling
GO:0048522	0.748	positive regulation of cellular process
GO:0051716	0.742	cellular response to stimulus
GO:0009966	0.736	regulation of signal transduction
GO:0031589	0.731	cell-substrate adhesion
GO:0007154	0.711	cell communication
GO:0050793	0.708	regulation of developmental process
GO:0023052	0.705	signaling
GO:0007165	0.702	signal transduction
GO:0071840	0.692	cellular component organization or biogenesis
GO:0016043	0.676	cellular component organization
GO:0051094	0.655	positive regulation of developmental process
GO:0007160	0.625	cell-matrix adhesion
GO:0051239	0.606	regulation of multicellular organismal process
GO:0007166	0.579	cell surface receptor signaling pathway
GO:0019222	0.506	regulation of metabolic process
GO:0030155	0.498	regulation of cell adhesion
GO:0045785	0.474	positive regulation of cell adhesion
GO:0048869	0.440	cellular developmental process
GO:0051240	0.438	positive regulation of multicellular organismal process
GO:0030154	0.418	cell differentiation
GO:0090092	0.409	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010811	0.407	positive regulation of cell-substrate adhesion
GO:0045229	0.385	external encapsulating structure organization
GO:0030198	0.380	extracellular matrix organization
GO:0009719	0.370	response to endogenous stimulus
GO:0060255	0.365	regulation of macromolecule metabolic process
GO:0090287	0.314	regulation of cellular response to growth factor stimulus
GO:0009888	0.301	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0043226	0.998	organelle
GO:0005576	0.994	extracellular region
GO:0031012	0.990	extracellular matrix
GO:0043227	0.978	membrane-bounded organelle
GO:0062023	0.970	collagen-containing extracellular matrix
GO:0005622	0.962	intracellular anatomical structure
GO:0005615	0.951	extracellular space
GO:0043229	0.927	intracellular organelle
GO:0031982	0.916	vesicle
GO:0070062	0.905	extracellular exosome
GO:0005737	0.821	cytoplasm
GO:0043231	0.731	intracellular membrane-bounded organelle
GO:0005886	0.707	plasma membrane
GO:0043228	0.517	non-membrane-bounded organelle
GO:0043232	0.409	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]