StarFunc result for job id Q6UXK2

User Input

>input (745 residues)
MFPLRALWLVWALLGVAGSCPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSA
NKITVLRRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNFISSFPWSDLR
NLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYH
NPFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCAPPSVHLSAE
PPLEAPGTPLRAGLAFVLHCIADGHPTPRLQWQLQIPGGTVVLEPPVLSGEDDGVGAEEG
EGEGDGDLLTQTQAQTPTPAPAWPAPPATPRFLALANGSLLVPLLSAKEAGVYTCRAHNE
LGANSTSIRVAVAATGPPKHAPGAGGEPDGQAPTSERKSTAKGRGNSVLPSKPEGKIKGQ
GLAKVSILGETETEPEEDTSEGEEAEDQILADPAEEQRCGNGDPSRYVSNHAFNQSAELK
PHVFELGVIALDVAEREARVQLTPLAARWGPGPGGAGGAPRPGRRPLRLLYLCPAGGGAA
VQWSRVEEGVNAYWFRGLRPGTNYSVCLALAGEACHVQVVFSTKKELPSLLVIVAVSVFL
LVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSYPA
GGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYS
DRLPLGAEAVNIAQEINGNYRQTAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5RKR3	0.658	0.658	0.000	745	0.895	0.895	Q5RKR3.pdb.gz	ISLR2_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Mus musculus OX=10090 GN=Islr2 PE=1 SV=1
2	AFDB:Q6UXK2	1.000	1.000	0.000	745	1.000	1.000	Q6UXK2.pdb.gz	ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens OX=9606 GN=ISLR2 PE=1 SV=1
3	AFDB:F1QNH9	0.424	0.444	2.585E-67	712	0.463	0.485	F1QNH9.pdb.gz
4	AFDB:O14498	0.434	0.746	1.511E-42	428	0.266	0.463	O14498.pdb.gz	ISLR_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein OS=Homo sapiens OX=9606 GN=ISLR PE=2 SV=1
5	AFDB:Q6GU68	0.429	0.737	2.494E-41	428	0.272	0.474	Q6GU68.pdb.gz	ISLR_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein OS=Mus musculus OX=10090 GN=Islr PE=1 SV=1
6	AFDB:D4A1J9	0.303	0.312	3.039E-31	719	0.192	0.199	D4A1J9.pdb.gz	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
7	AFDB:Q9VZZ4	0.339	0.176	5.979E-23	1527	0.173	0.084	Q9VZZ4.pdb.gz	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
8	AFDB:F8W4D7	0.220	0.257	4.106E-19	619	0.138	0.166	F8W4D7.pdb.gz
9	AFDB:A0A286YAB9	0.212	0.244	4.565E-19	628	0.150	0.178	A0A286YAB9.pdb.gz
10	AFDB:Q3URE9	0.237	0.278	4.439E-18	606	0.122	0.150	Q3URE9.pdb.gz	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
11	PDB:5y31B	0.206	0.288	1.773E-11	511	0.090	0.131	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
12	PDB:1xcdA	0.201	0.480	2.561E-9	305	0.058	0.141	1xcdA.pdb.gz
13	PDB:7wv3A	0.167	0.181	1.252E-8	668	0.066	0.073	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
14	PDB:2ft3F	0.202	0.482	1.155E-7	305	0.059	0.144	2ft3F.pdb.gz
15	PDB:5yq5B	0.190	0.419	1.673E-7	306	0.062	0.150	5yq5B.pdb.gz
16	PDB:7tvfD	0.154	0.210	2.422E-7	515	0.066	0.095	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
17	PDB:7p5vB	0.187	0.190	2.554E-7	732	0.060	0.061	7p5vB.pdb.gz
18	PDB:6gffI	0.185	0.244	2.839E-7	551	0.070	0.094	6gffI.pdb.gz
19	PDB:3t6qA	0.186	0.224	6.618E-7	601	0.060	0.075	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:6hkwA	0.184	0.431	2.619E-6	306	0.054	0.131	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5RKR3	0.0	1224	745	0.887	0.887	ISLR2_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Mus musculus OX=10090 GN=Islr2 PE=1 SV=1
2	Q6UXK2	0.0	1498	745	1.000	1.000	ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens OX=9606 GN=ISLR2 PE=1 SV=1
3	O14498	1.21e-119	367	428	0.279	0.486	ISLR_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein OS=Homo sapiens OX=9606 GN=ISLR PE=2 SV=1
4	Q6GU68	1.11e-117	362	428	0.281	0.488	ISLR_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein OS=Mus musculus OX=10090 GN=Islr PE=1 SV=1
5	W8DXL4	2.35e-31	132	681	0.122	0.134	LRIT3_MOUSE Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 OS=Mus musculus OX=10090 GN=Lrit3 PE=1 SV=1
6	Q3S2J2	2.65e-28	124	1524	0.111	0.054	Q3S2J2_DANRE Slit homolog 1 protein precursor OS=Danio rerio OX=7955 GN=slit1a PE=1 SV=1
7	Q3SXY7	1.23e-26	118	679	0.140	0.153	LRIT3_HUMAN Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRIT3 PE=1 SV=3
8	O75093	5.31e-26	117	1534	0.083	0.040	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
9	Q80TR4	9.47e-26	116	1531	0.083	0.040	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2
10	O88279	1.07e-25	116	1531	0.083	0.040	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
11	O94813	1.66e-25	115	1529	0.106	0.052	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
12	O75094	2.78e-25	115	1523	0.086	0.042	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
13	Q9R1B9	7.32e-25	113	1521	0.083	0.041	SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2
14	Q9DE36	7.49e-25	113	1512	0.085	0.042	Q9DE36_DANRE Slit homolog 2 protein precursor OS=Danio rerio OX=7955 GN=slit2 PE=1 SV=1
15	Q9WVC1	2.89e-24	110	766	0.083	0.081	SLIT2_RAT Slit homolog 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Slit2 PE=1 SV=3
16	D2XV92	2.96e-24	111	1513	0.083	0.041	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
17	Q9WVB4	8.13e-24	110	1523	0.083	0.041	SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus OX=10090 GN=Slit3 PE=2 SV=2
18	Q9NR99	1.04e-23	110	2828	0.107	0.028	MXRA5_HUMAN Matrix-remodeling-associated protein 5 OS=Homo sapiens OX=9606 GN=MXRA5 PE=1 SV=3
19	O88280	1.36e-23	109	1523	0.083	0.041	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
20	Q3Y6S4	2.56e-23	108	1532	0.085	0.041	Q3Y6S4_DANRE Slit homolog 1b precursor OS=Danio rerio OX=7955 GN=slit1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	2.2e+02	13.6	Fibronectin type III domain
2	PF07679 I-set	0.22	23.0	Immunoglobulin I-set domain
3	PF13895 Ig_2	0.36	22.5	Immunoglobulin domain
4	PF13927 Ig_3	0.23	23.3	Immunoglobulin domain
5	PF16920 LRRCT_2	21	16.6	Leucine rich repeat C-terminal motif
6	PF00560 LRR_1	66	15.4	Leucine Rich Repeat
7	PF12799 LRR_4	5.8e-09	47.3	Leucine Rich repeats (2 copies)
8	PF13855 LRR_8	2.9e-27	105.5	Leucine rich repeat
9	PF14580 LRR_9	0.4	21.7	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306864	0.857	Vasorin
2	9606.ENSP00000261435	0.770	NEDD4-binding protein 2
3	9606.ENSP00000376921	0.722	Netrin-G2
4	9606.ENSP00000278379	0.651	Excitatory amino acid transporter 2
5	9606.ENSP00000438284	0.639	cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
6	9606.ENSP00000480851	0.573	Serine/arginine repetitive matrix 3
7	9606.ENSP00000290438	0.566	Golgin A6 family member A
8	9606.ENSP00000347942	0.557	Proto-oncogene tyrosine-protein kinase receptor Ret
9	9606.ENSP00000437790	0.554	Cadherin-22
10	9606.ENSP00000381795	0.545	Coiled-coil domain containing 33
11	9606.ENSP00000219197	0.542	Cerebellin-1
12	9606.ENSP00000457703	0.535	Ubiquitin-like protein 7
13	9606.ENSP00000359085	0.525	Netrin-G1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0009987	0.984	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0016043	0.847	cellular component organization
GO:0048518	0.800	positive regulation of biological process
GO:0050770	0.733	regulation of axonogenesis
GO:0051239	0.694	regulation of multicellular organismal process
GO:0048522	0.677	positive regulation of cellular process
GO:0050767	0.653	regulation of neurogenesis
GO:0030516	0.616	regulation of axon extension
GO:0051130	0.615	positive regulation of cellular component organization
GO:0051962	0.610	positive regulation of nervous system development
GO:0045597	0.600	positive regulation of cell differentiation
GO:0031346	0.578	positive regulation of cell projection organization
GO:0032501	0.535	multicellular organismal process
GO:0032502	0.522	developmental process
GO:0050772	0.514	positive regulation of axonogenesis
GO:0048856	0.497	anatomical structure development
GO:0007275	0.418	multicellular organism development
GO:0045773	0.418	positive regulation of axon extension
GO:0048519	0.314	negative regulation of biological process
GO:0048731	0.308	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0071944	0.953	cell periphery
GO:0005622	0.923	intracellular anatomical structure
GO:0016020	0.921	membrane
GO:0009986	0.855	cell surface
GO:0043227	0.806	membrane-bounded organelle
GO:0005737	0.799	cytoplasm
GO:0043231	0.790	intracellular membrane-bounded organelle
GO:0031982	0.711	vesicle
GO:0005886	0.626	plasma membrane
GO:0005576	0.589	extracellular region
GO:0012505	0.554	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]