StarFunc result for job id Q6UXK5

User Input

>input (716 residues)
MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCND
LRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQ
LTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLK
VIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLANLRSLVLAGMYLTDIPGNALVGLDS
LESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGEL
VSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAIYQKTVESL
PNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSE
QCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSS
EGTLEISNIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSIL
VSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSN
IHQQTQKSCVNVTTKNAAFAVDISDQETSTALAAVMGSMFAVISLASIAVYFAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61809	0.710	0.710	0.000	716	0.937	0.937	Q61809.pdb.gz	LRRN1_MOUSE Leucine-rich repeat neuronal protein 1 OS=Mus musculus OX=10090 GN=Lrrn1 PE=2 SV=1
2	AFDB:A9JRH0	0.705	0.704	2.541E-99	717	0.793	0.792	A9JRH0.pdb.gz	A9JRH0_DANRE Leucine-rich repeat neuronal 1 OS=Danio rerio OX=7955 GN=lrrn1 PE=1 SV=1
3	AFDB:Q8CBC6	0.703	0.712	3.376E-77	707	0.513	0.519	Q8CBC6.pdb.gz	LRRN3_MOUSE Leucine-rich repeat neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrn3 PE=2 SV=1
4	AFDB:O75325	0.676	0.679	1.198E-73	713	0.465	0.467	O75325.pdb.gz	LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens OX=9606 GN=LRRN2 PE=2 SV=2
5	AFDB:Q3URE9	0.467	0.544	2.647E-30	606	0.243	0.287	Q3URE9.pdb.gz	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
6	AFDB:F8W4D7	0.464	0.528	4.351E-30	619	0.239	0.276	F8W4D7.pdb.gz
7	AFDB:A0A286YAB9	0.470	0.529	7.826E-30	628	0.225	0.256	A0A286YAB9.pdb.gz
8	AFDB:D4A1J9	0.244	0.243	5.972E-29	719	0.190	0.189	D4A1J9.pdb.gz	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
9	AFDB:Q9P244	0.240	0.227	1.687E-28	771	0.184	0.171	Q9P244.pdb.gz	LRFN1_HUMAN Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRFN1 PE=1 SV=2
10	AFDB:D4ABX8	0.240	0.260	2.115E-28	636	0.203	0.228	D4ABX8.pdb.gz	LRFN4_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrfn4 PE=1 SV=1
11	PDB:3t6qA	0.193	0.218	1.421E-12	601	0.141	0.168	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
12	PDB:7wv3A	0.177	0.186	2.800E-11	668	0.145	0.156	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:1xcdA	0.343	0.759	5.269E-11	305	0.117	0.275	1xcdA.pdb.gz
14	PDB:6gffI	0.344	0.433	1.705E-10	551	0.119	0.154	6gffI.pdb.gz
15	PDB:3b2dA	0.217	0.250	3.674E-10	601	0.135	0.161	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:7tvfD	0.246	0.304	6.608E-10	515	0.128	0.179	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
17	PDB:7wrqA	0.395	0.489	1.136E-9	566	0.117	0.148	7wrqA.pdb.gz
18	PDB:5y31B	0.209	0.288	2.340E-9	511	0.094	0.131	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
19	PDB:2ft3F	0.347	0.765	7.571E-9	305	0.108	0.252	2ft3F.pdb.gz
20	PDB:6hkwA	0.312	0.691	8.287E-9	306	0.102	0.239	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9JRH0	0.0	1200	717	0.803	0.802	A9JRH0_DANRE Leucine-rich repeat neuronal 1 OS=Danio rerio OX=7955 GN=lrrn1 PE=1 SV=1
2	O75325	0.0	675	713	0.461	0.463	LRRN2_HUMAN Leucine-rich repeat neuronal protein 2 OS=Homo sapiens OX=9606 GN=LRRN2 PE=2 SV=2
3	Q61809	0.0	1426	716	0.955	0.955	LRRN1_MOUSE Leucine-rich repeat neuronal protein 1 OS=Mus musculus OX=10090 GN=Lrrn1 PE=2 SV=1
4	Q6UXK5	0.0	1482	716	1.000	1.000	LRRN1_HUMAN Leucine-rich repeat neuronal protein 1 OS=Homo sapiens OX=9606 GN=LRRN1 PE=1 SV=1
5	Q8CBC6	0.0	746	707	0.520	0.526	LRRN3_MOUSE Leucine-rich repeat neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrn3 PE=2 SV=1
6	Q9ESY6	0.0	744	707	0.518	0.525	LRRN3_RAT Leucine-rich repeat neuronal protein 3 OS=Rattus norvegicus OX=10116 GN=Lrrn3 PE=2 SV=1
7	Q66HV9	6.70e-40	157	622	0.197	0.227	LIG1B_DANRE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B OS=Danio rerio OX=7955 GN=lingo1b PE=1 SV=1
8	Q3URE9	4.42e-39	155	606	0.205	0.243	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
9	Q9D1T0	5.45e-38	152	614	0.196	0.228	LIGO1_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Mus musculus OX=10090 GN=Lingo1 PE=1 SV=1
10	Q96FE5	1.17e-37	151	620	0.190	0.219	LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=LINGO1 PE=1 SV=2
11	Q149C3	2.41e-35	144	593	0.193	0.233	LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus OX=10090 GN=Lingo4 PE=2 SV=2
12	Q9VU53	2.20e-33	137	540	0.149	0.198	Q9VU53_DROME Capricious, isoform A OS=Drosophila melanogaster OX=7227 GN=caps PE=1 SV=3
13	O96671	4.27e-33	136	532	0.149	0.201	O96671_DROME CAPRICIOUS OS=Drosophila melanogaster OX=7227 GN=caps PE=2 SV=1
14	A0A0S0WP14	1.34e-32	137	811	0.149	0.132	A0A0S0WP14_DROME Capricious, isoform E OS=Drosophila melanogaster OX=7227 GN=caps PE=4 SV=1
15	Q0E8F0	1.82e-32	136	780	0.149	0.137	Q0E8F0_DROME Capricious, isoform D OS=Drosophila melanogaster OX=7227 GN=caps PE=4 SV=2
16	Q24250	3.25e-32	135	733	0.155	0.151	Q24250_DROME Tartan protein OS=Drosophila melanogaster OX=7227 GN=trn PE=2 SV=1
17	Q9VU51	5.29e-32	135	737	0.155	0.151	Q9VU51_DROME GH10871p OS=Drosophila melanogaster OX=7227 GN=trn PE=2 SV=1
18	M9PFH7	6.52e-32	134	751	0.155	0.148	M9PFH7_DROME Tartan, isoform B OS=Drosophila melanogaster OX=7227 GN=trn PE=4 SV=1
19	Q503I7	1.40e-31	133	647	0.187	0.207	Q503I7_DANRE Leucine rich repeat containing 4C isoform X1 OS=Danio rerio OX=7955 GN=zgc:110565 PE=1 SV=1
20	Q8C031	3.14e-31	132	640	0.156	0.175	LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16381 Coatomer_g_Cpla	4.2e+02	12.5	Coatomer subunit gamma-1 C-terminal appendage platform
2	PF00041 fn3	5.6	18.7	Fibronectin type III domain
3	PF07679 I-set	1.4e-13	62.0	Immunoglobulin I-set domain
4	PF00047 ig	1.9e-05	36.1	Immunoglobulin domain
5	PF13895 Ig_2	0.00011	33.7	Immunoglobulin domain
6	PF13927 Ig_3	1.4e-09	49.7	Immunoglobulin domain
7	PF16681 Ig_5	83	15.0	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF01463 LRRCT	2.9	19.7	Leucine rich repeat C-terminal domain
9	PF01462 LRRNT	1.1	20.2	Leucine rich repeat N-terminal domain
10	PF00560 LRR_1	1.3	20.6	Leucine Rich Repeat
11	PF12799 LRR_4	6e-21	85.4	Leucine Rich repeats (2 copies)
12	PF13306 LRR_5	5.9e-21	86.2	BspA type Leucine rich repeat region (6 copies)
13	PF13516 LRR_6	1.6e+02	13.8	Leucine Rich repeat
14	PF13855 LRR_8	1.5e-38	141.6	Leucine rich repeat
15	PF14580 LRR_9	8.3e-09	46.7	Leucine-rich repeat
16	PF16656 Pur_ac_phosph_N	14	17.7	Purple acid Phosphatase, N-terminal domain
17	PF07686 V-set	0.35	22.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314901

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359925	0.746	Leucine-rich repeat-containing protein 1
2	9606.ENSP00000366460	0.720	Plexin domain-containing protein 2
3	9606.ENSP00000379241	0.703	Leucine-rich repeat-containing protein 2
4	9606.ENSP00000300175	0.674	Neuroendocrine protein 7B2
5	9606.ENSP00000290039	0.647	VWFA and cache domain-containing protein 1
6	9606.ENSP00000356982	0.603	Ubiquitin-fold modifier-conjugating enzyme 1
7	9606.ENSP00000231948	0.596	Protein cereblon
8	9606.ENSP00000272902	0.579	Sulfatase-modifying factor 1
9	9606.ENSP00000321797	0.572	Fibroblast growth factor 8
10	9606.ENSP00000363533	0.570	Malate dehydrogenase 1B
11	9606.ENSP00000298288	0.559	Leucine-rich repeat protein 1
12	9606.ENSP00000374069	0.537	Receptor-type tyrosine-protein phosphatase N2
13	9606.ENSP00000373354	0.522	Histone-lysine N-methyltransferase SETMAR
14	9606.ENSP00000249363	0.517	Leucine-rich repeat-containing protein 4
15	9606.ENSP00000264254	0.504	Phosducin-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048518	0.903	positive regulation of biological process
GO:0009987	0.823	cellular process
GO:0048522	0.765	positive regulation of cellular process
GO:0032501	0.590	multicellular organismal process
GO:0051128	0.578	regulation of cellular component organization
GO:0032502	0.576	developmental process
GO:0051239	0.558	regulation of multicellular organismal process
GO:0048856	0.556	anatomical structure development
GO:0050793	0.555	regulation of developmental process
GO:0007275	0.552	multicellular organism development
GO:0051962	0.495	positive regulation of nervous system development
GO:0048731	0.464	system development
GO:0051130	0.458	positive regulation of cellular component organization
GO:0050807	0.458	regulation of synapse organization
GO:0051965	0.442	positive regulation of synapse assembly
GO:0050896	0.331	response to stimulus
GO:0048519	0.313	negative regulation of biological process
GO:0071840	0.308	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0016020	0.999	membrane
GO:0005886	0.963	plasma membrane
GO:0005622	0.869	intracellular anatomical structure
GO:0043229	0.660	intracellular organelle
GO:0005737	0.622	cytoplasm
GO:0005576	0.455	extracellular region
GO:0043227	0.454	membrane-bounded organelle
GO:0032991	0.376	protein-containing complex
GO:0005615	0.361	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]