StarFunc result for job id Q6UXL0

User Input

>input (311 residues)
MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAP
GETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQ
TSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHV
KMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAF
VGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
SPEELLRAWIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXL0	1.000	1.000	2.885E-54	311	1.000	1.000	Q6UXL0.pdb.gz	I20RB_HUMAN Interleukin-20 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL20RB PE=1 SV=1
2	AFDB:E9Q9A6	0.772	0.779	7.097E-42	308	0.752	0.760	E9Q9A6.pdb.gz	E9Q9A6_MOUSE Interleukin 20 receptor beta OS=Mus musculus OX=10090 GN=Il20rb PE=4 SV=1
3	AFDB:A0FJI0	0.458	0.400	4.244E-20	368	0.235	0.198	A0FJI0.pdb.gz
4	AFDB:K7NA32	0.443	0.358	9.812E-19	405	0.238	0.183	K7NA32.pdb.gz	IRA1A_ONCMY Interferon alpha/beta receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=ifnar1a PE=2 SV=1
5	AFDB:Q08334	0.430	0.415	1.648E-17	325	0.212	0.203	Q08334.pdb.gz	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
6	AFDB:Q9UHF4	0.413	0.259	1.062E-16	553	0.186	0.105	Q9UHF4.pdb.gz	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
7	AFDB:Q6PHB0	0.418	0.266	1.386E-16	546	0.203	0.115	Q6PHB0.pdb.gz	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2
8	AFDB:Q61190	0.433	0.395	3.248E-16	349	0.190	0.169	Q61190.pdb.gz	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
9	AFDB:D4A109	0.458	0.437	4.714E-16	330	0.225	0.212	D4A109.pdb.gz	D4A109_RAT Interferon gamma receptor 2 OS=Rattus norvegicus OX=10116 GN=Ifngr2 PE=4 SV=1
10	AFDB:Q3UVK9	0.459	0.435	5.832E-16	332	0.222	0.208	Q3UVK9.pdb.gz	Q3UVK9_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
11	PDB:7u7nC	0.322	0.462	1.843E-8	200	0.132	0.205	7u7nC.pdb.gz
12	PDB:3besR	0.382	0.452	2.537E-8	250	0.080	0.100	3besR.pdb.gz
13	PDB:7z0lB	0.291	0.255	6.975E-8	370	0.125	0.105	7z0lB.pdb.gz
14	PDB:6pyhD	0.265	0.123	1.866E-5	798	0.090	0.035	6pyhD.pdb.gz
15	PDB:4pygA	0.219	0.132	4.864E-5	685	0.084	0.038	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
16	PDB:8dtlA	0.248	0.119	4.864E-5	741	0.119	0.050	8dtlA.pdb.gz
17	PDB:8eyyA	0.258	0.123	1.745E-4	775	0.116	0.046	8eyyA.pdb.gz
18	PDB:5mj3A	0.239	0.246	3.134E-4	302	0.077	0.079	5mj3A.pdb.gz
19	PDB:6pxvA	0.249	0.113	3.306E-4	823	0.119	0.045	6pxvA.pdb.gz
20	PDB:5oj2B	0.254	0.139	5.060E-4	692	0.045	0.020	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXL0	0.0	641	311	1.000	1.000	I20RB_HUMAN Interleukin-20 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL20RB PE=1 SV=1
2	E9Q9A6	8.08e-173	483	308	0.765	0.773	E9Q9A6_MOUSE Interleukin 20 receptor beta OS=Mus musculus OX=10090 GN=Il20rb PE=4 SV=1
3	A0A142K3A7	8.28e-163	457	302	0.727	0.748	A0A142K3A7_MOUSE Interleukin-20 receptor subunit beta OS=Mus musculus OX=10090 GN=Il20rb PE=2 SV=1
4	Q3UVG8	1.94e-63	198	132	0.331	0.780	Q3UVG8_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Il20rb PE=2 SV=1
5	Q08334	1.83e-13	72.0	325	0.225	0.215	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
6	K7NA32	3.27e-10	62.8	405	0.238	0.183	IRA1A_ONCMY Interferon alpha/beta receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=ifnar1a PE=2 SV=1
7	Q61190	8.75e-10	61.2	349	0.206	0.183	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
8	P38484	8.80e-10	61.2	337	0.203	0.187	INGR2_HUMAN Interferon gamma receptor 2 OS=Homo sapiens OX=9606 GN=IFNGR2 PE=1 SV=2
9	D4A109	1.78e-09	60.1	330	0.228	0.215	D4A109_RAT Interferon gamma receptor 2 OS=Rattus norvegicus OX=10116 GN=Ifngr2 PE=4 SV=1
10	K7NAJ3	6.83e-09	58.5	388	0.235	0.188	IRA1B_ONCMY Interferon alpha/beta receptor 1b OS=Oncorhynchus mykiss OX=8022 GN=ifnar1b PE=2 SV=1
11	P33896	5.48e-08	56.2	590	0.241	0.127	INAR1_MOUSE Interferon alpha/beta receptor 1 OS=Mus musculus OX=10090 GN=Ifnar1 PE=1 SV=2
12	K9JA28	2.64e-07	54.3	567	0.209	0.115	INLR1_CHICK Interferon lambda receptor 1 OS=Gallus gallus OX=9031 GN=IFNLR1 PE=2 SV=1
13	Q3UVK9	2.93e-07	53.5	332	0.209	0.196	Q3UVK9_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
14	Q63953	4.62e-07	52.8	332	0.209	0.196	Q63953_MOUSE Ifngr2 protein OS=Mus musculus OX=10090 GN=Ifngr2 PE=1 SV=1
15	G3V830	1.04e-06	52.4	569	0.183	0.100	G3V830_RAT Interleukin 10 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il10ra PE=4 SV=1
16	A0A0G2JXD8	2.30e-06	51.2	439	0.193	0.137	A0A0G2JXD8_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=1
17	Q8C352	2.46e-06	49.7	213	0.190	0.277	Q8C352_MOUSE Fibronectin type-III domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Ifngr2 PE=2 SV=1
18	A0A8I6AH72	2.78e-06	50.8	582	0.193	0.103	A0A8I6AH72_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=1
19	D3ZDS9	2.88e-06	50.8	593	0.193	0.101	D3ZDS9_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=2
20	Q9UHF4	2.98e-06	50.8	553	0.186	0.105	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	0.06	25.0	Fibronectin type III domain
2	PF09294 Interfer-bind	0.029	26.0	Interferon-alpha/beta receptor, fibronectin type III
3	PF01108 Tissue_fac	5.8e-22	89.0	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328133

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270800	0.999	Interleukin-22 receptor subunit alpha-1
2	9606.ENSP00000375795	0.996	Interleukin-24
3	9606.ENSP00000314976	0.991	Interleukin-20 receptor subunit alpha
4	9606.ENSP00000356065	0.991	Interleukin-20
5	9606.ENSP00000343000	0.982	Interleukin-19
6	9606.ENSP00000412237	0.797	Interleukin-10
7	9606.ENSP00000329991	0.793	Interferon lambda-1
8	9606.ENSP00000333639	0.749	Interferon lambda-2
9	9606.ENSP00000264657	0.748	Signal transducer and activator of transcription 3
10	9606.ENSP00000409000	0.745	Interferon lambda-3
11	9606.ENSP00000371067	0.712	Tyrosine-protein kinase JAK2
12	9606.ENSP00000354394	0.709	Signal transducer and activator of transcription 1-alpha/beta
13	9606.ENSP00000442424	0.705	Interleukin-22
14	9606.ENSP00000302924	0.695	Interleukin-17D
15	9606.ENSP00000385675	0.692	Interleukin-6
16	9606.ENSP00000229134	0.685	Interleukin-26
17	9606.ENSP00000215781	0.682	Oncostatin-M
18	9606.ENSP00000343204	0.682	Tyrosine-protein kinase JAK1
19	9606.ENSP00000369581	0.678	Interferon beta
20	9606.ENSP00000480467	0.676	Interferon alpha-1/13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004896	0.597	cytokine receptor activity
GO:0019955	0.476	cytokine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0042127	0.995	regulation of cell population proliferation
GO:0002682	0.994	regulation of immune system process
GO:0070663	0.994	regulation of leukocyte proliferation
GO:0051716	0.989	cellular response to stimulus
GO:0048518	0.989	positive regulation of biological process
GO:0002376	0.988	immune system process
GO:0023052	0.987	signaling
GO:0007154	0.987	cell communication
GO:0048583	0.985	regulation of response to stimulus
GO:0001817	0.985	regulation of cytokine production
GO:0050865	0.980	regulation of cell activation
GO:0048519	0.978	negative regulation of biological process
GO:0009893	0.977	positive regulation of metabolic process
GO:0048523	0.969	negative regulation of cellular process
GO:0030155	0.961	regulation of cell adhesion
GO:0002694	0.961	regulation of leukocyte activation
GO:0001819	0.961	positive regulation of cytokine production
GO:0007165	0.960	signal transduction
GO:0031347	0.959	regulation of defense response
GO:0032944	0.945	regulation of mononuclear cell proliferation
GO:0032101	0.944	regulation of response to external stimulus
GO:0022407	0.944	regulation of cell-cell adhesion
GO:0051249	0.936	regulation of lymphocyte activation
GO:0010605	0.935	negative regulation of macromolecule metabolic process
GO:0050727	0.934	regulation of inflammatory response
GO:0006950	0.930	response to stress
GO:0051241	0.919	negative regulation of multicellular organismal process
GO:0002697	0.918	regulation of immune effector process
GO:0032501	0.916	multicellular organismal process
GO:1903037	0.916	regulation of leukocyte cell-cell adhesion
GO:0050863	0.911	regulation of T cell activation
GO:0050670	0.900	regulation of lymphocyte proliferation
GO:0008285	0.893	negative regulation of cell population proliferation
GO:0006952	0.873	defense response
GO:0001775	0.868	cell activation
GO:0048585	0.859	negative regulation of response to stimulus
GO:0010629	0.852	negative regulation of gene expression
GO:0002822	0.842	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0042129	0.836	regulation of T cell proliferation
GO:0001818	0.822	negative regulation of cytokine production
GO:0032733	0.807	positive regulation of interleukin-10 production
GO:0006955	0.805	immune response
GO:0002820	0.805	negative regulation of adaptive immune response
GO:0048522	0.801	positive regulation of cellular process
GO:0032649	0.801	regulation of type II interferon production
GO:0050866	0.800	negative regulation of cell activation
GO:0002706	0.797	regulation of lymphocyte mediated immunity
GO:0051250	0.764	negative regulation of lymphocyte activation
GO:0002260	0.753	lymphocyte homeostasis
GO:0006954	0.726	inflammatory response
GO:0050868	0.724	negative regulation of T cell activation
GO:0002673	0.720	regulation of acute inflammatory response
GO:0070664	0.708	negative regulation of leukocyte proliferation
GO:0002861	0.668	regulation of inflammatory response to antigenic stimulus
GO:0032689	0.651	negative regulation of type II interferon production
GO:0008283	0.602	cell population proliferation
GO:0031323	0.570	regulation of cellular metabolic process
GO:0002764	0.487	immune response-regulating signaling pathway
GO:0051171	0.485	regulation of nitrogen compound metabolic process
GO:0045321	0.453	leukocyte activation
GO:0002698	0.413	negative regulation of immune effector process
GO:0031325	0.399	positive regulation of cellular metabolic process
GO:0008284	0.396	positive regulation of cell population proliferation
GO:0007166	0.395	cell surface receptor signaling pathway
GO:0002823	0.393	negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002704	0.392	negative regulation of leukocyte mediated immunity
GO:0032945	0.388	negative regulation of mononuclear cell proliferation
GO:0080090	0.385	regulation of primary metabolic process
GO:0043029	0.381	T cell homeostasis
GO:0051173	0.376	positive regulation of nitrogen compound metabolic process
GO:0048584	0.362	positive regulation of response to stimulus
GO:0032663	0.362	regulation of interleukin-2 production
GO:0050672	0.355	negative regulation of lymphocyte proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.741	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]