StarFunc result for job id Q6UXM1

User Input

>input (1119 residues)
MSAPSLRARAAGLGLLLCAVLGRAGRSDSGGRGELGQPSGVAAERPCPTTCRCLGDLLDC
SRKRLARLPEPLPSWVARLDLSHNRLSFIKASSMSHLQSLREVKLNNNELETIPNLGPVS
ANITLLSLAGNRIVEILPEHLKEFQSLETLDLSSNNISELQTAFPALQLKYLYLNSNRVT
SMEPGYFDNLANTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGA
LKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAIN
RISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSS
LKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDN
AIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQSFVNASCAHPQLLKG
RSIFAVSPDGFVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNEL
LHDAEMENYAHLRAQGGEVMEYTTILRLREVEFASEGKYQCVISNHFGSSYSVKAKLTVN
MLPSFTKTPMDLTIRAGAMARLECAAVGHPAPQIAWQKDGGTDFPAARERRMHVMPEDDV
FFIVDVKIEDIGVYSCTAQNSAGSISANATLTVLETPSFLRPLLDRTVTKGETAVLQCIA
GGSPPPKLNWTKDDSPLVVTERHFFAAGNQLLIIVDSDVSDAGKYTCEMSNTLGTERGNV
RLSVIPTPTCDSPQMTAPSLDDDGWATVGVVIIAVVCCVVGTSLVWVVIIYHTRRRNEDC
SITNTDETNLPADIPSYLSSQGTLADRQDGYVSSESGSHHQFVTSSGAGFFLPQHDSSGT
CHIDNSSEADVEAATDLFLCPFLGSTGPMYLKGNVYGSDPFETYHTGCSPDPRTVLMDHY
EPSYIKKKECYPCSHPSEESCERSFSNISWPSHVRKLLNTSYSHNEGPGMKNLCLNKSSL
DFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSG
SEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94898	0.642	0.673	0.000	1065	0.548	0.576	O94898.pdb.gz	LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=1 SV=3
2	AFDB:Q6P1C6	0.691	0.692	0.000	1117	0.859	0.860	Q6P1C6.pdb.gz	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
3	AFDB:Q6UXM1	1.000	1.000	0.000	1119	1.000	1.000	Q6UXM1.pdb.gz	LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=1 SV=1
4	AFDB:P70193	0.491	0.503	4.343E-97	1091	0.484	0.497	P70193.pdb.gz	LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus OX=10090 GN=Lrig1 PE=1 SV=2
5	AFDB:Q3V1M1	0.181	0.081	9.813E-27	2594	0.159	0.069	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
6	AFDB:F1RE66	0.171	0.169	2.727E-20	1134	0.124	0.123	F1RE66.pdb.gz	F1RE66_DANRE Roundabout homolog 4 isoform X1 OS=Danio rerio OX=7955 GN=robo4 PE=4 SV=1
7	AFDB:A0A2R8QRK0	0.149	0.120	2.075E-19	1420	0.125	0.099	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
8	AFDB:Q96NW7	0.313	0.233	1.877E-15	1537	0.171	0.124	Q96NW7.pdb.gz	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
9	AFDB:Q96RT1	0.302	0.242	6.064E-15	1412	0.164	0.130	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
10	PDB:6dldD	0.176	0.597	9.088E-15	269	0.048	0.201	6dldD.pdb.gz
11	AFDB:P70587	0.304	0.231	1.248E-14	1490	0.141	0.106	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
12	PDB:7wv3A	0.179	0.261	7.918E-14	668	0.112	0.187	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:6dlfA	0.161	0.623	5.031E-13	236	0.047	0.225	6dlfA.pdb.gz
14	PDB:7tvfD	0.263	0.508	1.035E-12	515	0.086	0.186	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
15	PDB:7wrqA	0.292	0.535	7.199E-12	566	0.123	0.244	7wrqA.pdb.gz
16	PDB:5oj2B	0.128	0.190	2.223E-11	692	0.059	0.095	5oj2B.pdb.gz
17	PDB:6gffI	0.305	0.596	5.478E-11	551	0.108	0.220	6gffI.pdb.gz
18	PDB:3t6qA	0.240	0.412	5.731E-11	601	0.102	0.190	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
19	PDB:3b2dA	0.195	0.311	1.179E-10	601	0.105	0.195	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:1xcdA	0.162	0.534	5.223E-10	305	0.068	0.249	1xcdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94898	0.0	1129	1065	0.523	0.549	LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=1 SV=3
2	P70193	0.0	994	1091	0.452	0.464	LRIG1_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Mus musculus OX=10090 GN=Lrig1 PE=1 SV=2
3	Q52KR2	0.0	1121	1054	0.500	0.531	LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1
4	Q6P1C6	0.0	1941	1117	0.860	0.861	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
5	Q6UXM1	0.0	2325	1119	1.000	1.000	LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=1 SV=1
6	Q96JA1	0.0	969	1093	0.440	0.450	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2
7	Q965M2	2.85e-104	350	881	0.216	0.275	SMA10_CAEEL Leucine-rich repeats and immunoglobulin-like domains protein sma-10 OS=Caenorhabditis elegans OX=6239 GN=sma-10 PE=1 SV=1
8	Q3UQ28	4.61e-57	218	1475	0.141	0.107	PXDN_MOUSE Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2
9	Q92626	1.00e-54	211	1479	0.137	0.103	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2
10	Q149C3	3.65e-38	154	593	0.131	0.248	LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus OX=10090 GN=Lingo4 PE=2 SV=2
11	Q8TF66	3.81e-38	154	581	0.122	0.236	LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens OX=9606 GN=LRRC15 PE=1 SV=2
12	Q9VZZ4	6.50e-36	150	1527	0.113	0.083	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
13	Q3URE9	1.67e-35	146	606	0.139	0.257	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
14	Q9D1T0	3.51e-35	145	614	0.124	0.226	LIGO1_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Mus musculus OX=10090 GN=Lingo1 PE=1 SV=1
15	F1RCV3	3.63e-35	148	1516	0.130	0.096	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
16	Q96FE5	3.90e-35	145	620	0.124	0.224	LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=LINGO1 PE=1 SV=2
17	Q3UVD5	7.63e-35	146	967	0.123	0.143	LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus OX=10090 GN=Lgr6 PE=2 SV=1
18	D2XV92	1.17e-34	147	1513	0.124	0.092	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
19	O88279	1.19e-34	147	1531	0.125	0.091	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
20	Q80TR4	1.57e-34	146	1531	0.125	0.091	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.6	19.8	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1.5e-05	36.2	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	1.1e-43	158.5	Immunoglobulin I-set domain
4	PF00047 ig	1.4e-19	81.3	Immunoglobulin domain
5	PF13895 Ig_2	2.5e-22	90.3	Immunoglobulin domain
6	PF13927 Ig_3	6.5e-39	143.7	Immunoglobulin domain
7	PF16681 Ig_5	0.026	26.3	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF01463 LRRCT	1.7e+02	14.1	Leucine rich repeat C-terminal domain
9	PF00560 LRR_1	2.1e-05	35.2	Leucine Rich Repeat
10	PF12799 LRR_4	1.2e-32	122.5	Leucine Rich repeats (2 copies)
11	PF13306 LRR_5	2.6e-22	90.6	BspA type Leucine rich repeat region (6 copies)
12	PF13516 LRR_6	2.1e+02	13.5	Leucine Rich repeat
13	PF13855 LRR_8	4.5e-65	226.6	Leucine rich repeat
14	PF14580 LRR_9	1.6e-12	58.8	Leucine-rich repeat
15	PF16101 PRIMA1	2e+02	13.4	Proline-rich membrane anchor 1
16	PF07686 V-set	1.8e-06	39.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385735	0.842	Galactosylceramide sulfotransferase
2	9606.ENSP00000258739	0.798	ER lumen protein-retaining receptor 2
3	9606.ENSP00000371483	0.798	Sodium-dependent phosphate transport protein 2B
4	9606.ENSP00000335605	0.780	CKLF like MARVEL transmembrane domain containing 7
5	9606.ENSP00000275493	0.762	Epidermal growth factor receptor
6	9606.ENSP00000369681	0.724	Ubiquitin carboxyl-terminal hydrolase 3
7	9606.ENSP00000263102	0.714	Coiled-coil domain containing 6
8	9606.ENSP00000273261	0.700	Leucine-rich repeats and immunoglobulin-like domains protein 1
9	9606.ENSP00000357494	0.678	Proto-oncogene tyrosine-protein kinase ROS
10	9606.ENSP00000361818	0.666	Syndecan-4
11	9606.ENSP00000269571	0.662	Receptor tyrosine-protein kinase erbB-2
12	9606.ENSP00000357516	0.656	Tropomyosin alpha-3 chain
13	9606.ENSP00000357484	0.641	Golgi-associated PDZ and coiled-coil motif-containing protein
14	9606.ENSP00000009530	0.630	HLA class II histocompatibility antigen gamma chain
15	9606.ENSP00000216294	0.628	snRNA-activating protein complex subunit 1
16	9606.ENSP00000357196	0.625	Receptor-type tyrosine-protein phosphatase kappa
17	9606.ENSP00000295851	0.604	Abl interactor 2
18	9606.ENSP00000231484	0.600	Protocadherin-12
19	9606.ENSP00000367151	0.596	Protocadherin-17
20	9606.ENSP00000316891	0.594	LIM and calponin homology domains 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.500	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.965	biological regulation
GO:0048856	0.962	anatomical structure development
GO:0032501	0.959	multicellular organismal process
GO:0009987	0.958	cellular process
GO:0050789	0.955	regulation of biological process
GO:0050794	0.938	regulation of cellular process
GO:0007275	0.803	multicellular organism development
GO:0048513	0.747	animal organ development
GO:0042471	0.582	ear morphogenesis
GO:0048731	0.468	system development
GO:0048518	0.457	positive regulation of biological process
GO:0019222	0.452	regulation of metabolic process
GO:0048840	0.438	otolith development
GO:0050896	0.437	response to stimulus
GO:0048519	0.434	negative regulation of biological process
GO:0060255	0.428	regulation of macromolecule metabolic process
GO:0048583	0.408	regulation of response to stimulus
GO:0080090	0.404	regulation of primary metabolic process
GO:0051171	0.404	regulation of nitrogen compound metabolic process
GO:0048523	0.403	negative regulation of cellular process
GO:0042472	0.397	inner ear morphogenesis
GO:0023051	0.371	regulation of signaling
GO:0048522	0.347	positive regulation of cellular process
GO:0010646	0.343	regulation of cell communication
GO:0007399	0.313	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.995	organelle
GO:0043227	0.993	membrane-bounded organelle
GO:0016020	0.988	membrane
GO:0005576	0.973	extracellular region
GO:0005622	0.937	intracellular anatomical structure
GO:0043229	0.916	intracellular organelle
GO:0031982	0.906	vesicle
GO:0005737	0.866	cytoplasm
GO:0005615	0.848	extracellular space
GO:0071944	0.843	cell periphery
GO:0043231	0.821	intracellular membrane-bounded organelle
GO:0005886	0.766	plasma membrane
GO:0012505	0.323	endomembrane system
GO:0120025	0.300	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]