StarFunc result for job id Q6UXN2

User Input

>input (200 residues)
MAWGGVHTCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSP
SRCTLLVTSSKPWTAVQKSHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIIT
VLRNISLVVSPAPTTSPMWTLPWLPTSTVLITSPEGTSGHPSINGSETRKSRAPACLGSG
GPRFLVLVLCGLLLAKGLML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXN2	1.000	1.000	6.968E-37	200	1.000	1.000	Q6UXN2.pdb.gz	TRML4_HUMAN Trem-like transcript 4 protein OS=Homo sapiens OX=9606 GN=TREML4 PE=2 SV=1
2	AFDB:Q3LRV9	0.589	0.452	8.432E-21	263	0.500	0.380	Q3LRV9.pdb.gz	TRML4_MOUSE Trem-like transcript 4 protein OS=Mus musculus OX=10090 GN=Treml4 PE=1 SV=1
3	AFDB:O95944	0.550	0.405	6.990E-17	276	0.350	0.254	O95944.pdb.gz	NCTR2_HUMAN Natural cytotoxicity triggering receptor 2 OS=Homo sapiens OX=9606 GN=NCR2 PE=1 SV=2
4	AFDB:Q9JKE2	0.508	0.446	8.730E-12	230	0.230	0.200	Q9JKE2.pdb.gz	TREM1_MOUSE Triggering receptor expressed on myeloid cells 1 OS=Mus musculus OX=10090 GN=Trem1 PE=1 SV=1
5	AFDB:D4ABU7	0.523	0.467	1.151E-11	226	0.250	0.221	D4ABU7.pdb.gz	D4ABU7_RAT Triggering receptor expressed on myeloid cells 1 OS=Rattus norvegicus OX=10116 GN=Trem1 PE=4 SV=2
6	AFDB:Q9NP99	0.522	0.451	2.364E-11	234	0.230	0.197	Q9NP99.pdb.gz	TREM1_HUMAN Triggering receptor expressed on myeloid cells 1 OS=Homo sapiens OX=9606 GN=TREM1 PE=1 SV=1
7	AFDB:Q08708	0.475	0.428	4.347E-11	224	0.245	0.219	Q08708.pdb.gz	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
8	AFDB:Q8VCH2	0.474	0.432	5.424E-11	221	0.245	0.222	Q8VCH2.pdb.gz	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
9	AFDB:Q8BNV8	0.437	0.385	8.927E-11	229	0.290	0.253	Q8BNV8.pdb.gz	Q8BNV8_MOUSE Plasmacytoid dendritic cell-specific receptor OS=Mus musculus OX=10090 GN=A530064D06Rik PE=1 SV=1
10	AFDB:Q9UGN4	0.469	0.327	1.315E-10	299	0.210	0.140	Q9UGN4.pdb.gz	CLM8_HUMAN CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A PE=1 SV=2
11	PDB:5hhmI	0.442	0.450	1.087E-6	196	0.095	0.097	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
12	PDB:6xdsA	0.431	0.188	1.998E-6	485	0.135	0.056	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.
13	PDB:5ir3A	0.417	0.704	2.111E-6	111	0.105	0.189	5ir3A.pdb.gz
14	PDB:1bd2D	0.462	0.485	2.359E-6	190	0.085	0.089	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.
15	PDB:6jxrm	0.453	0.371	3.475E-6	248	0.115	0.093	6jxrm.pdb.gz
16	PDB:4y5xB	0.393	0.663	1.312E-5	111	0.110	0.198	4y5xB.pdb.gz
17	PDB:1cd0A	0.402	0.677	1.549E-5	111	0.095	0.171	1cd0A.pdb.gz
18	PDB:4aizA	0.392	0.685	1.730E-5	107	0.095	0.178	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
19	PDB:6sm1A	0.397	0.672	1.933E-5	111	0.115	0.207	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
20	PDB:2cd0A	0.386	0.654	2.549E-5	111	0.105	0.189	2cd0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXN2	3.98e-147	408	200	1.000	1.000	TRML4_HUMAN Trem-like transcript 4 protein OS=Homo sapiens OX=9606 GN=TREML4 PE=2 SV=1
2	Q3LRV9	3.76e-50	165	263	0.480	0.365	TRML4_MOUSE Trem-like transcript 4 protein OS=Mus musculus OX=10090 GN=Treml4 PE=1 SV=1
3	O95944	4.30e-32	119	276	0.405	0.293	NCTR2_HUMAN Natural cytotoxicity triggering receptor 2 OS=Homo sapiens OX=9606 GN=NCR2 PE=1 SV=2
4	Q8VCH2	4.00e-14	70.1	221	0.260	0.235	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
5	Q6SJQ7	4.15e-10	60.1	337	0.190	0.113	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
6	Q6SJQ5	1.08e-09	58.5	245	0.205	0.167	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
7	P01832	2.95e-08	55.1	773	0.175	0.045	PIGR_RABIT Polymeric immunoglobulin receptor OS=Oryctolagus cuniculus OX=9986 GN=PIGR PE=1 SV=1
8	Q5T2D2	6.02e-08	53.9	321	0.210	0.131	TRML2_HUMAN Trem-like transcript 2 protein OS=Homo sapiens OX=9606 GN=TREML2 PE=1 SV=2
9	Q8BNV8	6.74e-08	53.1	229	0.295	0.258	Q8BNV8_MOUSE Plasmacytoid dendritic cell-specific receptor OS=Mus musculus OX=10090 GN=A530064D06Rik PE=1 SV=1
10	Q3U497	1.22e-07	52.0	209	0.195	0.187	CLM7_MOUSE CMRF35-like molecule 7 OS=Mus musculus OX=10090 GN=Cd300lb PE=1 SV=2
11	P01833	2.57e-07	52.4	764	0.160	0.042	PIGR_HUMAN Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4
12	D4ABU7	2.89e-07	51.2	226	0.280	0.248	D4ABU7_RAT Triggering receptor expressed on myeloid cells 1 OS=Rattus norvegicus OX=10116 GN=Trem1 PE=4 SV=2
13	Q1ERP8	5.41e-07	51.2	331	0.155	0.094	CLM9_MOUSE CMRF35-like molecule 9 OS=Mus musculus OX=10090 GN=Cd300lg PE=1 SV=1
14	P15083	6.89e-07	51.2	769	0.125	0.033	PIGR_RAT Polymeric immunoglobulin receptor OS=Rattus norvegicus OX=10116 GN=Pigr PE=1 SV=1
15	Q8WWV6	1.34e-06	50.1	532	0.160	0.060	FCAMR_HUMAN High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor OS=Homo sapiens OX=9606 GN=FCAMR PE=1 SV=1
16	Q496F6	1.38e-06	49.3	205	0.180	0.176	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
17	Q9JKE2	4.65e-06	47.8	230	0.130	0.113	TREM1_MOUSE Triggering receptor expressed on myeloid cells 1 OS=Mus musculus OX=10090 GN=Trem1 PE=1 SV=1
18	Q8TDQ1	4.67e-06	48.1	290	0.145	0.100	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
19	A8K4G0	8.46e-06	47.0	201	0.160	0.159	CLM7_HUMAN CMRF35-like molecule 7 OS=Homo sapiens OX=9606 GN=CD300LB PE=1 SV=2
20	Q9JKE1	1.04e-05	46.2	183	0.160	0.175	TREM3_MOUSE Triggering receptor expressed on myeloid cells 3 OS=Mus musculus OX=10090 GN=Trem3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	10	17.7	Immunoglobulin domain
2	PF07686 V-set	9.3e-11	53.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000402855	0.790	Trem-like transcript 1 protein
2	9606.ENSP00000262629	0.770	TYRO protein tyrosine kinase-binding protein
3	9606.ENSP00000244709	0.754	Triggering receptor expressed on myeloid cells 1
4	9606.ENSP00000376397	0.736	CMRF35-like molecule 7
5	9606.ENSP00000362205	0.682	Triggering receptor expressed on myeloid cells 2
6	9606.ENSP00000256196	0.629	Ras-related protein R-Ras2
7	9606.ENSP00000462309	0.627	CMRF35-like molecule 1
8	9606.ENSP00000329507	0.620	CMRF35-like molecule 6
9	9606.ENSP00000348074	0.577	C-type lectin domain family 9 member A
10	9606.ENSP00000376395	0.568	CMRF35-like molecule 2
11	9606.ENSP00000353259	0.565	CMRF35-like molecule 8
12	9606.ENSP00000418767	0.521	Trem-like transcript 2 protein
13	9606.ENSP00000378536	0.511	Zinc finger and BTB domain-containing protein 46
14	9606.ENSP00000321005	0.504	CMRF35-like molecule 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.680	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0048522	0.967	positive regulation of cellular process
GO:0045089	0.948	positive regulation of innate immune response
GO:0050896	0.814	response to stimulus
GO:0062207	0.814	regulation of pattern recognition receptor signaling pathway
GO:0009967	0.801	positive regulation of signal transduction
GO:0009987	0.784	cellular process
GO:0062208	0.730	positive regulation of pattern recognition receptor signaling pathway
GO:0039531	0.668	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0051716	0.430	cellular response to stimulus
GO:0007154	0.372	cell communication
GO:0007165	0.341	signal transduction
GO:0002376	0.340	immune system process
GO:0006950	0.311	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]