StarFunc result for job id Q6UXS9

User Input

>input (341 residues)
MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVD
DITETAQIAGKIFREHLWNSKKQLSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELD
LLGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGICG
TKHWDQEPDVLHDDTIFEIFNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASAD
THGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS
HHLEEIFQKVQHSFETPNILTQLPTIERLSMTRYFYLFPGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXS9	1.000	1.000	6.463E-68	341	1.000	1.000	Q6UXS9.pdb.gz	CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens OX=9606 GN=CASP12 PE=2 SV=3
2	AFDB:Q920D5	0.705	0.574	6.871E-45	420	0.595	0.483	Q920D5.pdb.gz	CASPC_RAT Caspase-12 OS=Rattus norvegicus OX=10116 GN=Casp12 PE=1 SV=1
3	AFDB:O08736	0.681	0.557	2.073E-43	419	0.589	0.480	O08736.pdb.gz	CASPC_MOUSE Caspase-12 OS=Mus musculus OX=10090 GN=Casp12 PE=1 SV=1
4	AFDB:P49662	0.683	0.620	1.666E-40	377	0.519	0.469	P49662.pdb.gz	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
5	AFDB:O75601	0.682	0.618	3.063E-39	377	0.537	0.485	O75601.pdb.gz	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
6	AFDB:P51878	0.674	0.533	1.533E-38	434	0.493	0.387	P51878.pdb.gz	CASP5_HUMAN Caspase-5 OS=Homo sapiens OX=9606 GN=CASP5 PE=1 SV=3
7	AFDB:P70343	0.653	0.599	1.380E-34	373	0.390	0.357	P70343.pdb.gz	CASP4_MOUSE Caspase-4 OS=Mus musculus OX=10090 GN=Casp4 PE=1 SV=2
8	AFDB:E9PSM0	0.650	0.624	4.163E-33	356	0.396	0.379	E9PSM0.pdb.gz	E9PSM0_RAT Caspase 4 OS=Rattus norvegicus OX=10116 GN=Casp4 PE=3 SV=4
9	AFDB:P29466	0.626	0.530	1.626E-32	404	0.416	0.351	P29466.pdb.gz	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
10	AFDB:O42284	0.671	0.803	6.353E-32	283	0.323	0.389	O42284.pdb.gz	O42284_CHICK Caspase-1 OS=Gallus gallus OX=9031 PE=2 SV=1
11	PDB:4pryA	0.597	0.810	5.032E-20	249	0.196	0.269	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
12	PDB:4fdlB	0.568	0.805	3.433E-19	239	0.152	0.218	4fdlB.pdb.gz
13	PDB:4nblA	0.556	0.728	2.730E-15	258	0.164	0.217	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
14	PDB:4iyrB	0.487	0.847	1.181E-12	191	0.141	0.251	4iyrB.pdb.gz
15	PDB:2wdpD	0.502	0.724	9.705E-12	230	0.152	0.226	2wdpD.pdb.gz
16	PDB:7wzsB	0.503	0.818	9.705E-12	206	0.135	0.223	7wzsB.pdb.gz
17	PDB:4fguA	0.401	0.342	2.303E-5	407	0.100	0.084	4fguA.pdb.gz
18	PDB:5wbjA	0.308	0.112	4.233E-4	1058	0.059	0.019	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
19	PDB:6w8rA	0.430	0.405	4.740E-3	364	0.109	0.102	6w8rA.pdb.gz
20	PDB:1jkjB	0.195	0.175	6.873E-3	388	0.053	0.046	1jkjB.pdb.gz	Two glutamate residues, Glu 208 alpha and Glu 197 beta, are crucial for phosphorylation and dephosphorylation of the active-site histidine residue in succinyl-CoA synthetase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXS9	0.0	713	341	1.000	1.000	CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens OX=9606 GN=CASP12 PE=2 SV=3
2	O08736	4.76e-118	349	419	0.484	0.394	CASPC_MOUSE Caspase-12 OS=Mus musculus OX=10090 GN=Casp12 PE=1 SV=1
3	Q920D5	4.33e-117	347	420	0.481	0.390	CASPC_RAT Caspase-12 OS=Rattus norvegicus OX=10116 GN=Casp12 PE=1 SV=1
4	P49662	2.76e-109	325	377	0.525	0.475	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
5	O75601	9.07e-108	321	377	0.531	0.480	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
6	P51878	2.37e-95	291	434	0.422	0.332	CASP5_HUMAN Caspase-5 OS=Homo sapiens OX=9606 GN=CASP5 PE=1 SV=3
7	P29466	7.01e-92	281	404	0.399	0.337	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
8	P70343	4.90e-88	271	373	0.399	0.365	CASP4_MOUSE Caspase-4 OS=Mus musculus OX=10090 GN=Casp4 PE=1 SV=2
9	Q3MHS1	3.61e-86	266	373	0.393	0.359	Q3MHS1_RAT Caspase 4, apoptosis-related cysteine peptidase OS=Rattus norvegicus OX=10116 GN=Casp4 PE=2 SV=1
10	E9PSM0	7.82e-86	266	400	0.393	0.335	E9PSM0_RAT Caspase 4 OS=Rattus norvegicus OX=10116 GN=Casp4 PE=3 SV=4
11	P29452	1.24e-85	266	402	0.446	0.378	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
12	P43527	1.05e-84	263	402	0.370	0.313	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
13	O42284	3.01e-66	212	283	0.349	0.420	O42284_CHICK Caspase-1 OS=Gallus gallus OX=9031 PE=2 SV=1
14	Q9I9L7	1.02e-46	164	383	0.302	0.269	CASPA_DANRE Caspase a OS=Danio rerio OX=7955 GN=caspa PE=1 SV=1
15	A0A060XPX2	5.40e-41	148	353	0.252	0.244	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
16	Q504J1	1.06e-34	133	404	0.258	0.218	CASPB_DANRE Caspase b OS=Danio rerio OX=7955 GN=caspb PE=1 SV=1
17	W0TYK3	1.39e-24	101	213	0.173	0.277	W0TYK3_ONCMY Caspase 1b (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=casp1b PE=2 SV=1
18	D3YT61	4.70e-23	99.0	287	0.226	0.268	D3YT61_CAEEL Cell death protein 3 subunit p17 OS=Caenorhabditis elegans OX=6239 GN=ced-3 PE=1 SV=1
19	P42573	1.40e-21	97.4	503	0.226	0.153	CED3_CAEEL Cell death protein 3 OS=Caenorhabditis elegans OX=6239 GN=ced-3 PE=1 SV=2
20	Q9IB67	2.92e-20	93.2	423	0.217	0.175	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	4.9e-12	57.0	Caspase recruitment domain
2	PF00656 Peptidase_C14	9.7e-37	138.5	Caspase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000047678

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000003379	0.886	Calpain 2, (M/II) large subunit
2	9598.ENSPTRP00000006670	0.878	Uncharacterized protein
3	9598.ENSPTRP00000042795	0.873	Apoptotic protease-activating factor 1
4	9598.ENSPTRP00000005216	0.858	Uncharacterized protein
5	9598.ENSPTRP00000054330	0.844	Caspase-3
6	9598.ENSPTRP00000041166	0.836	Caspase 1, apoptosis-related cysteine peptidase
7	9598.ENSPTRP00000030365	0.782	Cytidine monophosphate-N-acetylneuraminic acid hydroxylase
8	9598.ENSPTRP00000000984	0.747	Heat shock 70kDa protein 5 (Glucose-regulated protein, 78kDa)
9	9598.ENSPTRP00000043666	0.723	DNA damage-inducible transcript 3 protein
10	9598.ENSPTRP00000002668	0.687	Activating transcription factor 6
11	9598.ENSPTRP00000036949	0.683	Belongs to the TNF receptor-associated factor family.
12	9598.ENSPTRP00000032465	0.665	Cytochrome c
13	9598.ENSPTRP00000016199	0.635	Endoplasmic reticulum to nucleus signaling 1
14	9598.ENSPTRP00000043317	0.622	Mitogen-activated protein kinase kinase kinase 5
15	9598.ENSPTRP00000009129	0.607	Endoplasmin
16	9598.ENSPTRP00000024464	0.604	X-box binding protein 1
17	9598.ENSPTRP00000026701	0.594	Uncharacterized protein
18	9598.ENSPTRP00000010961	0.593	Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
19	9598.ENSPTRP00000011569	0.593	Uncharacterized protein
20	9598.ENSPTRP00000006883	0.591	FAS-associated death domain protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004197	0.999	cysteine-type endopeptidase activity
GO:0019899	0.963	enzyme binding
GO:0019904	0.952	protein domain specific binding
GO:0042802	0.676	identical protein binding
GO:0098772	0.674	molecular function regulator activity
GO:0002020	0.448	protease binding
GO:0030234	0.439	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0048518	0.993	positive regulation of biological process
GO:0071704	0.992	organic substance metabolic process
GO:0006915	0.991	apoptotic process
GO:0050794	0.990	regulation of cellular process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0048522	0.982	positive regulation of cellular process
GO:1901564	0.967	organonitrogen compound metabolic process
GO:0006950	0.962	response to stress
GO:0023052	0.937	signaling
GO:0043170	0.924	macromolecule metabolic process
GO:0051716	0.922	cellular response to stimulus
GO:0007154	0.910	cell communication
GO:0019538	0.910	protein metabolic process
GO:0006508	0.902	proteolysis
GO:0019222	0.882	regulation of metabolic process
GO:0042221	0.876	response to chemical
GO:0010033	0.874	response to organic substance
GO:0048583	0.866	regulation of response to stimulus
GO:0060255	0.858	regulation of macromolecule metabolic process
GO:0007165	0.858	signal transduction
GO:0070887	0.853	cellular response to chemical stimulus
GO:0080090	0.848	regulation of primary metabolic process
GO:0051171	0.848	regulation of nitrogen compound metabolic process
GO:0042981	0.847	regulation of apoptotic process
GO:0009893	0.822	positive regulation of metabolic process
GO:0051173	0.814	positive regulation of nitrogen compound metabolic process
GO:0071310	0.801	cellular response to organic substance
GO:0010604	0.793	positive regulation of macromolecule metabolic process
GO:0023051	0.784	regulation of signaling
GO:0010646	0.783	regulation of cell communication
GO:0065009	0.774	regulation of molecular function
GO:0043065	0.773	positive regulation of apoptotic process
GO:0009628	0.704	response to abiotic stimulus
GO:0051246	0.683	regulation of protein metabolic process
GO:0032501	0.668	multicellular organismal process
GO:0009966	0.640	regulation of signal transduction
GO:0048584	0.632	positive regulation of response to stimulus
GO:0033554	0.588	cellular response to stress
GO:0050790	0.586	regulation of catalytic activity
GO:0097190	0.576	apoptotic signaling pathway
GO:0007275	0.571	multicellular organism development
GO:0023056	0.512	positive regulation of signaling
GO:0010647	0.510	positive regulation of cell communication
GO:0030162	0.507	regulation of proteolysis
GO:0051247	0.506	positive regulation of protein metabolic process
GO:0044093	0.498	positive regulation of molecular function
GO:0080134	0.488	regulation of response to stress
GO:0097193	0.474	intrinsic apoptotic signaling pathway
GO:0034976	0.472	response to endoplasmic reticulum stress
GO:0048731	0.461	system development
GO:0009605	0.459	response to external stimulus
GO:0009967	0.450	positive regulation of signal transduction
GO:0010467	0.445	gene expression
GO:0010468	0.441	regulation of gene expression
GO:0052548	0.438	regulation of endopeptidase activity
GO:0045862	0.431	positive regulation of proteolysis
GO:1901698	0.397	response to nitrogen compound
GO:1901700	0.395	response to oxygen-containing compound
GO:0051345	0.393	positive regulation of hydrolase activity
GO:2000116	0.391	regulation of cysteine-type endopeptidase activity
GO:0048513	0.385	animal organ development
GO:0044237	0.370	cellular metabolic process
GO:0071214	0.368	cellular response to abiotic stimulus
GO:0043281	0.357	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0010952	0.352	positive regulation of peptidase activity
GO:0031323	0.335	regulation of cellular metabolic process
GO:0010243	0.334	response to organonitrogen compound
GO:1901701	0.323	cellular response to oxygen-containing compound
GO:0030154	0.311	cell differentiation
GO:0031325	0.311	positive regulation of cellular metabolic process
GO:0010628	0.310	positive regulation of gene expression
GO:0016485	0.307	protein processing
GO:0009607	0.306	response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0005829	0.972	cytosol
GO:0005783	0.968	endoplasmic reticulum
GO:0016020	0.658	membrane
GO:0032991	0.529	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	0.999	Cysteine endopeptidases.

[back to server]