StarFunc result for job id Q6UXU4

User Input

>input (331 residues)
MKTSRRGRALLAVALNLLALLFATTAFLTTHWCQGTQRVPKPGCGQGGRANCPNSGANAT
ANGTAAPAAAAAAATASGNGPPGGALYSWETGDDRFLFRNFHTGIWYSCEEELSGLGEKC
RSFIDLAPASEKGVLWLSVVSEVLYILLLVVGFSLMCLELFHSSNVIDGLKLNAFAAVFT
VLSGLLGMVAHMMYTQVFQVTVSLGPEDWRPHSWDYGWSFCLAWGSFTCCMAASVTTLNS
YTKTVIEFRHKRKVFEQGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPAR
HQPHMADSWPRSSAQEAPELNRQCWVLGHWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXU4	1.000	1.000	3.193E-51	331	1.000	1.000	Q6UXU4.pdb.gz	GSG1L_HUMAN Germ cell-specific gene 1-like protein OS=Homo sapiens OX=9606 GN=GSG1L PE=1 SV=2
2	AFDB:Q2KHT4	0.649	0.617	1.453E-24	349	0.411	0.390	Q2KHT4.pdb.gz	GSG1_HUMAN Germ cell-specific gene 1 protein OS=Homo sapiens OX=9606 GN=GSG1 PE=1 SV=2
3	AFDB:Q8R1W2	0.626	0.639	8.460E-24	324	0.396	0.404	Q8R1W2.pdb.gz	GSG1_MOUSE Germ cell-specific gene 1 protein OS=Mus musculus OX=10090 GN=Gsg1 PE=1 SV=2
4	PDB:7rzaA	0.539	0.185	2.620E-21	981	0.529	0.178	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
5	AFDB:O88602	0.539	0.552	4.240E-10	323	0.169	0.173	O88602.pdb.gz	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
6	AFDB:Q6PFS3	0.547	0.558	5.537E-10	324	0.187	0.191	Q6PFS3.pdb.gz	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
7	AFDB:G5EDT2	0.539	0.492	6.855E-10	366	0.130	0.117	G5EDT2.pdb.gz	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1
8	AFDB:O60359	0.498	0.522	9.442E-10	315	0.175	0.184	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
9	AFDB:Q8VHW9	0.533	0.539	2.897E-9	327	0.184	0.187	Q8VHW9.pdb.gz	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
10	AFDB:Q8WXS5	0.519	0.412	3.055E-9	425	0.187	0.146	Q8WXS5.pdb.gz	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
11	AFDB:Q8VHW8	0.481	0.565	1.876E-8	275	0.172	0.207	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
12	PDB:7rz4A	0.473	0.170	1.715E-7	993	0.127	0.042	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
13	PDB:7ocaI	0.469	0.809	6.512E-7	185	0.127	0.227	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
14	PDB:5b2gC	0.357	0.340	4.156E-4	350	0.100	0.094	5b2gC.pdb.gz
15	PDB:5weoA	0.441	0.157	5.427E-4	988	0.133	0.045	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
16	PDB:6jp5E	0.355	0.644	6.369E-4	169	0.103	0.201	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
17	PDB:6wxuB	0.349	0.409	2.174E-3	273	0.094	0.114	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
18	PDB:7d3eB	0.330	0.382	2.419E-3	272	0.094	0.114	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
19	PDB:6ov2A	0.393	0.660	2.552E-3	182	0.106	0.192	6ov2A.pdb.gz
20	PDB:5kk2E	0.385	0.661	8.709E-3	173	0.082	0.156	5kk2E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z7H4	0.0	553	322	0.894	0.919	GSG1L_MOUSE Germ cell-specific gene 1-like protein OS=Mus musculus OX=10090 GN=Gsg1l PE=1 SV=2
2	D3ZK93	0.0	553	322	0.894	0.919	GSG1L_RAT Germ cell-specific gene 1-like protein OS=Rattus norvegicus OX=10116 GN=Gsg1l PE=1 SV=1
3	Q6UXU4	0.0	691	331	1.000	1.000	GSG1L_HUMAN Germ cell-specific gene 1-like protein OS=Homo sapiens OX=9606 GN=GSG1L PE=1 SV=2
4	Q2KHT4	1.86e-76	240	349	0.384	0.364	GSG1_HUMAN Germ cell-specific gene 1 protein OS=Homo sapiens OX=9606 GN=GSG1 PE=1 SV=2
5	Q8R1W2	4.60e-71	225	324	0.378	0.386	GSG1_MOUSE Germ cell-specific gene 1 protein OS=Mus musculus OX=10090 GN=Gsg1 PE=1 SV=2
6	O60359	0.011	39.7	315	0.127	0.133	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
7	P62955	0.018	38.9	275	0.106	0.127	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
8	P62956	0.018	38.9	275	0.106	0.127	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
9	P62957	0.018	38.9	275	0.106	0.127	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
10	Q9Y698	0.089	36.6	323	0.118	0.121	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1
11	O88602	0.093	36.6	323	0.118	0.121	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
12	Q71RJ2	0.093	36.6	323	0.118	0.121	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
13	Q6PFS3	0.095	36.6	324	0.121	0.123	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
14	Q8VHX0	0.13	36.2	315	0.118	0.124	CCG3_RAT Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1
15	Q9JJV5	0.13	36.2	315	0.118	0.124	CCG3_MOUSE Voltage-dependent calcium channel gamma-3 subunit OS=Mus musculus OX=10090 GN=Cacng3 PE=1 SV=2
16	Q9UF02	0.15	35.8	275	0.133	0.160	CCG5_HUMAN Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens OX=9606 GN=CACNG5 PE=2 SV=2
17	P56857	0.19	35.4	264	0.085	0.106	CLD18_MOUSE Claudin-18 OS=Mus musculus OX=10090 GN=Cldn18 PE=1 SV=1
18	Q8VHW8	0.21	35.4	275	0.133	0.160	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
19	Q8VHW9	0.26	35.4	327	0.060	0.061	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
20	Q9JJV4	0.26	35.4	327	0.060	0.061	CCG4_MOUSE Voltage-dependent calcium channel gamma-4 subunit OS=Mus musculus OX=10090 GN=Cacng4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	0.9	20.8	PMP-22/EMP/MP20/Claudin tight junction
2	PF07803 GSG-1	4.8e-43	157.0	GSG1-like protein
3	PF00822 PMP22_Claudin	2.6e-05	35.7	PMP-22/EMP/MP20/Claudin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394954

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366058	0.810	Synapse differentiation-inducing gene protein 1
2	9606.ENSP00000454014	0.775	Protein shisa-9
3	9606.ENSP00000296526	0.763	Glutamate receptor 2
4	9606.ENSP00000216416	0.752	Protein cornichon homolog 1
5	9606.ENSP00000310003	0.752	Protein cornichon homolog 2
6	9606.ENSP00000273590	0.747	T-cell leukemia translocation-altered gene protein
7	9606.ENSP00000300105	0.689	Voltage-dependent calcium channel gamma-2 subunit
8	9606.ENSP00000477141	0.675	DOMON domain-containing protein FRRS1L
9	9606.ENSP00000211413	0.629	Interferon induced transmembrane protein domain containing
10	9606.ENSP00000272133	0.577	Protein cornichon homolog 3
11	9606.ENSP00000420315	0.564	Monoacylglycerol lipase ABHD6
12	9606.ENSP00000359819	0.551	Motile sperm domain-containing protein 1
13	9606.ENSP00000428994	0.545	Glutamate receptor 1
14	9606.ENSP00000229002	0.533	Ras-related and estrogen-regulated growth inhibitor-like protein
15	9606.ENSP00000394842	0.525	Grancalcin
16	9606.ENSP00000402460	0.523	Calsyntenin-2
17	9606.ENSP00000270458	0.522	Voltage-dependent calcium channel gamma-8 subunit
18	9606.ENSP00000355621	0.515	Tetratricopeptide repeat domain containing
19	9606.ENSP00000330606	0.507	Heparan sulfate glucosamine 3-O-sulfotransferase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0051049	0.959	regulation of transport
GO:0032409	0.885	regulation of transporter activity
GO:0010469	0.884	regulation of signaling receptor activity
GO:0099601	0.856	regulation of neurotransmitter receptor activity
GO:0034762	0.790	regulation of transmembrane transport
GO:0032412	0.709	regulation of monoatomic ion transmembrane transporter activity
GO:0051239	0.676	regulation of multicellular organismal process
GO:0044057	0.440	regulation of system process
GO:0009987	0.437	cellular process
GO:0051128	0.376	regulation of cellular component organization
GO:0031644	0.349	regulation of nervous system process
GO:0065008	0.346	regulation of biological quality
GO:0048259	0.307	regulation of receptor-mediated endocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098978	0.996	glutamatergic synapse
GO:0098839	0.996	postsynaptic density membrane
GO:0005622	0.717	intracellular anatomical structure
GO:0043227	0.703	membrane-bounded organelle
GO:0043229	0.700	intracellular organelle
GO:0043231	0.514	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]