StarFunc result for job id Q6UXV0

User Input

>input (394 residues)
MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKM
RNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTR
SHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPF
NIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTF
QSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSE
ESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMT
VTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXV0	1.000	1.000	2.186E-57	394	1.000	1.000	Q6UXV0.pdb.gz	GFRAL_HUMAN GDNF family receptor alpha-like OS=Homo sapiens OX=9606 GN=GFRAL PE=1 SV=2
2	AFDB:Q6SJE0	0.596	0.598	3.756E-40	393	0.703	0.705	Q6SJE0.pdb.gz	GFRAL_MOUSE GDNF family receptor alpha-like OS=Mus musculus OX=10090 GN=Gfral PE=1 SV=2
3	AFDB:A0A0B4K6R0	0.365	0.176	8.159E-11	864	0.180	0.082	A0A0B4K6R0.pdb.gz	A0A0B4K6R0_DROME Glial cell line-derived neurotrophic family receptor-like, isoform F OS=Drosophila melanogaster OX=7227 GN=Gfrl PE=3 SV=1
4	AFDB:A0A0B4LIE3	0.361	0.143	1.157E-9	1042	0.185	0.070	A0A0B4LIE3.pdb.gz	A0A0B4LIE3_DROME Glial cell line-derived neurotrophic family receptor-like, isoform M OS=Drosophila melanogaster OX=7227 GN=Gfrl PE=3 SV=1
5	AFDB:O35118	0.399	0.397	3.402E-9	397	0.198	0.196	O35118.pdb.gz	GFRA3_MOUSE GDNF family receptor alpha-3 OS=Mus musculus OX=10090 GN=Gfra3 PE=2 SV=1
6	AFDB:P97785	0.394	0.337	3.558E-9	468	0.150	0.126	P97785.pdb.gz	GFRA1_MOUSE GDNF family receptor alpha-1 OS=Mus musculus OX=10090 GN=Gfra1 PE=1 SV=2
7	AFDB:O60609	0.394	0.389	4.072E-9	400	0.203	0.200	O60609.pdb.gz	GFRA3_HUMAN GDNF family receptor alpha-3 OS=Homo sapiens OX=9606 GN=GFRA3 PE=1 SV=2
8	AFDB:A0A0B4K6A2	0.382	0.138	1.568E-8	1168	0.135	0.045	A0A0B4K6A2.pdb.gz	A0A0B4K6A2_DROME Glial cell line-derived neurotrophic family receptor-like, isoform I OS=Drosophila melanogaster OX=7227 GN=Gfrl PE=3 SV=1
9	AFDB:E7F4G1	0.403	0.350	1.716E-8	458	0.180	0.155	E7F4G1.pdb.gz	E7F4G1_DANRE GDNF family receptor alpha 3 OS=Danio rerio OX=7955 GN=gfra3 PE=2 SV=1
10	AFDB:K9J968	0.379	0.403	3.853E-8	369	0.198	0.211	K9J968.pdb.gz	K9J968_HUMAN GDNF family receptor alpha-3 variant OS=Homo sapiens OX=9606 GN=GDNFR3 PE=2 SV=1
11	PDB:6q2nC	0.351	0.654	1.530E-6	200	0.114	0.225	6q2nC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
12	PDB:6q2sC	0.367	0.697	5.891E-6	199	0.127	0.251	6q2sC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
13	PDB:6gl7C	0.379	0.490	1.514E-5	297	0.150	0.199	6gl7C.pdb.gz
14	PDB:7rhqG	0.162	0.343	2.542E-3	160	0.089	0.219	7rhqG.pdb.gz	Structural basis for catalyzed assembly of the Sonic hedgehog-Patched1 signaling complex.
15	PDB:4j6sB	0.102	0.143	4.886E-1	243	0.079	0.128	4j6sB.pdb.gz	The N-terminal sequence of tyrosine hydroxylase is a conformationally versatile motif that binds 14-3-3 proteins and membranes.
16	PDB:3axyC	0.168	0.238	5.591E-1	235	0.071	0.119	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
17	PDB:4zdrA	0.147	0.201	1.003	243	0.084	0.136	4zdrA.pdb.gz	Structure of the 14-3-3 zeta-LKB1 fusion protein provides insight into a novel ligand-binding mode of 14-3-3.
18	PDB:7stmA	0.104	0.065	1.200	801	0.069	0.034	7stmA.pdb.gz	Structural basis for inhibition and regulation of a chitin synthase from Candida albicans.
19	PDB:3gniA	0.148	0.166	1.313	335	0.089	0.104	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
20	PDB:4hm9A	0.117	0.096	1.503	511	0.104	0.080	4hm9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6SJE0	0.0	569	393	0.703	0.705	GFRAL_MOUSE GDNF family receptor alpha-like OS=Mus musculus OX=10090 GN=Gfral PE=1 SV=2
2	Q6UXV0	0.0	822	394	1.000	1.000	GFRAL_HUMAN GDNF family receptor alpha-like OS=Homo sapiens OX=9606 GN=GFRAL PE=1 SV=2
3	P56159	2.50e-10	64.3	465	0.135	0.114	GFRA1_HUMAN GDNF family receptor alpha-1 OS=Homo sapiens OX=9606 GN=GFRA1 PE=1 SV=2
4	Q62997	5.47e-10	63.2	468	0.137	0.115	GFRA1_RAT GDNF family receptor alpha-1 OS=Rattus norvegicus OX=10116 GN=Gfra1 PE=1 SV=1
5	F7F1M3	1.06e-09	62.0	402	0.190	0.187	F7F1M3_RAT GDNF family receptor alpha 3 OS=Rattus norvegicus OX=10116 GN=Gfra3 PE=3 SV=1
6	Q6AXR3	1.43e-09	61.6	397	0.178	0.176	Q6AXR3_RAT GDNF family receptor alpha 3 OS=Rattus norvegicus OX=10116 GN=Gfra3 PE=2 SV=1
7	P97785	2.33e-09	61.2	468	0.132	0.111	GFRA1_MOUSE GDNF family receptor alpha-1 OS=Mus musculus OX=10090 GN=Gfra1 PE=1 SV=2
8	Q98TT9	5.52e-09	60.1	472	0.170	0.142	Q98TT9_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfralpha1a PE=1 SV=2
9	A0A8I6A8G6	1.91e-08	57.8	331	0.135	0.160	A0A8I6A8G6_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=3 SV=1
10	A0A8I6B3J9	1.97e-08	58.5	506	0.132	0.103	A0A8I6B3J9_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=3 SV=1
11	O35977	2.55e-08	57.8	464	0.132	0.112	O35977_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=2 SV=1
12	O00451	3.04e-08	57.8	464	0.129	0.110	GFRA2_HUMAN GDNF family receptor alpha-2 OS=Homo sapiens OX=9606 GN=GFRA2 PE=1 SV=2
13	O08842	8.81e-08	56.2	464	0.124	0.106	GFRA2_MOUSE GDNF family receptor alpha-2 OS=Mus musculus OX=10090 GN=Gfra2 PE=1 SV=2
14	Q98TT8	1.14e-07	55.8	481	0.117	0.096	Q98TT8_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfralpha1b PE=2 SV=2
15	O35118	2.03e-07	55.1	397	0.175	0.174	GFRA3_MOUSE GDNF family receptor alpha-3 OS=Mus musculus OX=10090 GN=Gfra3 PE=2 SV=1
16	O60609	6.61e-07	53.5	400	0.168	0.165	GFRA3_HUMAN GDNF family receptor alpha-3 OS=Homo sapiens OX=9606 GN=GFRA3 PE=1 SV=2
17	K9J968	2.45e-06	51.6	369	0.137	0.146	K9J968_HUMAN GDNF family receptor alpha-3 variant OS=Homo sapiens OX=9606 GN=GDNFR3 PE=2 SV=1
18	A0A0B4K785	4.44e-06	51.2	1212	0.127	0.041	A0A0B4K785_DROME Glial cell line-derived neurotrophic family receptor-like, isoform G OS=Drosophila melanogaster OX=7227 GN=Gfrl PE=3 SV=1
19	A0A0B4K7J4	4.60e-06	51.2	1279	0.127	0.039	A0A0B4K7J4_DROME Glial cell line-derived neurotrophic family receptor-like, isoform E OS=Drosophila melanogaster OX=7227 GN=Gfrl PE=3 SV=1
20	A0A0B4KH06	4.72e-06	51.2	1217	0.127	0.041	A0A0B4KH06_DROME Glial cell line-derived neurotrophic family receptor-like, isoform L OS=Drosophila melanogaster OX=7227 GN=Gfrl PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02351 GDNF	6.1e-18	76.8	GDNF/GAS1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343636

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252809	0.997	Growth differentiation factor 15
2	9606.ENSP00000347942	0.992	Proto-oncogene tyrosine-protein kinase receptor Ret
3	9606.ENSP00000245810	0.774	Persephin
4	9606.ENSP00000381654	0.770	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
5	9606.ENSP00000387435	0.745	Artemin
6	9606.ENSP00000409007	0.725	Glial cell line-derived neurotrophic factor
7	9606.ENSP00000302648	0.672	Neurturin
8	9606.ENSP00000356925	0.615	Fc receptor-like B
9	9606.ENSP00000355157	0.612	Fc receptor-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016167	1.000	glial cell-derived neurotrophic factor receptor activity
GO:0030971	1.000	receptor tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.990	response to stimulus
GO:0007165	0.981	signal transduction
GO:1902531	0.980	regulation of intracellular signal transduction
GO:0048522	0.968	positive regulation of cellular process
GO:0043408	0.964	regulation of MAPK cascade
GO:0010647	0.960	positive regulation of cell communication
GO:0023056	0.959	positive regulation of signaling
GO:0007167	0.953	enzyme-linked receptor protein signaling pathway
GO:0009967	0.951	positive regulation of signal transduction
GO:0043410	0.939	positive regulation of MAPK cascade
GO:0007169	0.901	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0032501	0.859	multicellular organismal process
GO:0051897	0.719	positive regulation of protein kinase B signaling
GO:0048856	0.342	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.957	intracellular anatomical structure
GO:0043226	0.899	organelle
GO:0043229	0.886	intracellular organelle
GO:0031981	0.868	nuclear lumen
GO:0005654	0.860	nucleoplasm
GO:0043232	0.772	intracellular non-membrane-bounded organelle
GO:0005737	0.652	cytoplasm
GO:0009986	0.558	cell surface
GO:0098552	0.402	side of membrane
GO:0009897	0.383	external side of plasma membrane
GO:0030054	0.353	cell junction
GO:0005856	0.301	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]