StarFunc result for job id Q6UXX5

User Input

>input (1313 residues)
MSGWRYLICVSFLLTILLELTYQGPPVPASSSTKLLMTSYSMRSTVVSRYAHTLVTSVLF
NPHAEAHEAIFDLDLPHLAFISNFTMTINNKVYIAEVKEKHQAKKIYEEAHQQGKTAAHV
GIRDRESEKFRISTSLAAGTEVTFSLAYEELLQRHQGQYQLVVSLRPGQLVKRLSIEVTV
SERTGISYVHIPPLRTGRLRTNAHASEVDSPPSTRIERGETCVRITYCPTLQDQSSISGS
GIMADFLVQYDVVMEDIIGDVQIYDDYFIHYFAPRGLPPMEKNVVFVIDVSSSMFGTKME
QTKTAMNVILSDLQANDYFNIISFSDTVNVWKAGGSIQATIQNVHSAKDYLHCMEADGWT
DVNSALLAAASVLNHSNQEPGRGPSVGRIPLIIFLTDGEPTAGVTTPSVILSNVRQALGH
RVSLFSLAFGDDADFTLLRRLSLENRGIARRIYEDTDAALQLKGLYEEISMPLLADVRLN
YLGGLVGASPWAVFPNYFGGSELVVAGQVQPGKQELGIHLAARGPKDQLLVAHHSEGATN
NSQKAFGCPGEPAPNVAHFIRRLWAYVTIGELLDAHFQARDTTTRHLLAAKVLNLSLEYN
FVTPLTSLVMVQPKQASEETRRQTSTSAGPDTIMPSSSSRHGLGVSTAQPALVPKVISPK
SRPVKPKFYLSSTTTASTKKMLSSKELEPLGESPHTLSMPTYPKAKIPAQQDSGTLAQPT
LRTKPTILVPSNSGTLLPLKPGSLSHQNPDILPTNSRTQVPPVKPGIPASPKADTVKCVT
PLHSKPGAPSHPQLGALTSQAPKGLPQSRPGVSTLQVPKYPLHTRPRVPAPKTRNNMPHL
GPGILLSKTPKILLSLKPSAPPHQISTSISLSKPETPNPHMPQTPLPPRPDRPRPPLPES
LSTFPNTISSSTGPSSTTTTSVLGEPLPMPFTPTLPPGRFWHQYDLLPGPQRTRQVLGPS
RPGVPTMSLLNSSRPTPEGSPPNLPILLPSSILPEAISLLLLPEELELLSESMVESKFVE
SLNPPAFYTFLTPDEDGSPNWDGNSEEILGGAGGSMESQGSSVGLAKGTLPSIFTFSSSV
DGDPHFVIQIPHSEEKICFTLNGHPGDLLQLIEDPKAGLHVSGKLLGAPPRPGHKDQTRT
YFQIITVTTDKPRAYTITISRSSISLRGEGTLRLSWDQPALLKRPQLELYVAAAARLTLR
LGPYLEFLVLRHRYRHPSTLQLPHLGFYVANGSGLSPSARGLIGQFQHADIRLVTGPMGP
CLRRHHGPDVPVILGKRLLKDSPRLLPRWASCWLVKRSHVELLLGHPYLSYVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXX5	1.000	1.000	0.000	1313	1.000	1.000	Q6UXX5.pdb.gz	ITIH6_HUMAN Inter-alpha-trypsin inhibitor heavy chain H6 OS=Homo sapiens OX=9606 GN=ITIH6 PE=1 SV=1
2	AFDB:E9PYK3	0.330	0.227	1.759E-37	1969	0.177	0.118	E9PYK3.pdb.gz	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
3	PDB:1m2vA	0.170	0.293	1.448E-9	705	0.040	0.074	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
4	PDB:6zgaB	0.173	0.271	7.810E-9	786	0.034	0.056	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
5	PDB:6jp8F	0.128	0.168	4.211E-8	973	0.043	0.058	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
6	PDB:6zgaA	0.176	0.283	4.432E-8	751	0.036	0.063	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
7	AFDB:E9Q7P1	0.131	0.109	6.722E-8	1613	0.106	0.086	E9Q7P1.pdb.gz	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
8	PDB:5kynA	0.184	0.309	9.059E-8	730	0.036	0.064	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
9	AFDB:A0A0R4IR54	0.134	0.111	4.446E-7	1622	0.097	0.078	A0A0R4IR54.pdb.gz
10	AFDB:Q8NFW1	0.127	0.105	4.679E-7	1626	0.117	0.094	Q8NFW1.pdb.gz	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
11	PDB:6gym6	0.124	0.453	1.106E-6	335	0.020	0.078	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
12	PDB:6ujaB	0.137	0.420	1.356E-6	359	0.034	0.123	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
13	PDB:7nupD	0.102	0.143	1.751E-6	884	0.045	0.067	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand
14	PDB:7ad8D	0.119	0.497	3.231E-6	280	0.021	0.100	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
15	PDB:4g1eB	0.135	0.231	3.766E-6	709	0.028	0.052	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
16	AFDB:Q63661	0.110	0.064	3.938E-3	2344	0.088	0.049	Q63661.pdb.gz	MUC4_RAT Mucin-4 OS=Rattus norvegicus OX=10116 GN=Muc4 PE=1 SV=2
17	AFDB:Q9JM52	0.055	0.056	3.938E-3	1308	0.084	0.084	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
18	AFDB:O48847	0.067	0.099	6.562E-3	787	0.077	0.128	O48847.pdb.gz	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1
19	AFDB:A0A0G2K490	0.066	0.064	8.914E-3	1360	0.077	0.074	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
20	AFDB:A0A0R4IEP9	0.048	0.047	1.093E-2	1332	0.089	0.088	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXX5	0.0	2666	1313	1.000	1.000	ITIH6_HUMAN Inter-alpha-trypsin inhibitor heavy chain H6 OS=Homo sapiens OX=9606 GN=ITIH6 PE=1 SV=1
2	Q8BJD1	3.63e-131	429	952	0.180	0.248	ITIH5_MOUSE Inter-alpha-trypsin inhibitor heavy chain H5 OS=Mus musculus OX=10090 GN=Itih5 PE=1 SV=1
3	Q86UX2	6.38e-129	423	942	0.190	0.264	ITIH5_HUMAN Inter-alpha-trypsin inhibitor heavy chain H5 OS=Homo sapiens OX=9606 GN=ITIH5 PE=2 SV=2
4	Q06033	1.27e-120	399	890	0.185	0.273	ITIH3_HUMAN Inter-alpha-trypsin inhibitor heavy chain H3 OS=Homo sapiens OX=9606 GN=ITIH3 PE=1 SV=2
5	A6X935	3.23e-120	399	942	0.182	0.254	ITIH4_MOUSE Inter alpha-trypsin inhibitor, heavy chain 4 OS=Mus musculus OX=10090 GN=Itih4 PE=1 SV=2
6	Q5EBC0	1.94e-117	391	933	0.182	0.256	Q5EBC0_RAT Inter-alpha-trypsin inhibitor heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Itih4 PE=4 SV=1
7	D3ZFC6	3.04e-117	391	927	0.182	0.258	D3ZFC6_RAT Inter-alpha-trypsin inhibitor heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Itih4 PE=1 SV=4
8	Q3T052	2.63e-116	388	916	0.175	0.251	ITIH4_BOVIN Inter-alpha-trypsin inhibitor heavy chain H4 OS=Bos taurus OX=9913 GN=ITIH4 PE=1 SV=1
9	Q14624	2.69e-114	383	930	0.177	0.251	ITIH4_HUMAN Inter-alpha-trypsin inhibitor heavy chain H4 OS=Homo sapiens OX=9606 GN=ITIH4 PE=1 SV=4
10	Q61704	3.27e-113	379	889	0.175	0.259	ITIH3_MOUSE Inter-alpha-trypsin inhibitor heavy chain H3 OS=Mus musculus OX=10090 GN=Itih3 PE=1 SV=3
11	P79263	1.89e-109	369	921	0.182	0.260	ITIH4_PIG Inter-alpha-trypsin inhibitor heavy chain H4 OS=Sus scrofa OX=9823 GN=ITIH4 PE=1 SV=1
12	P19823	2.53e-109	369	946	0.159	0.221	ITIH2_HUMAN Inter-alpha-trypsin inhibitor heavy chain H2 OS=Homo sapiens OX=9606 GN=ITIH2 PE=1 SV=2
13	Q63416	5.61e-109	367	887	0.172	0.255	ITIH3_RAT Inter-alpha-trypsin inhibitor heavy chain H3 OS=Rattus norvegicus OX=10116 GN=Itih3 PE=2 SV=1
14	O35802	6.92e-109	368	932	0.177	0.250	O35802_RAT Inter-alpha-inhibitor H4 heavy chain OS=Rattus norvegicus OX=10116 GN=Itih4 PE=2 SV=1
15	Q61703	5.63e-108	366	946	0.155	0.216	ITIH2_MOUSE Inter-alpha-trypsin inhibitor heavy chain H2 OS=Mus musculus OX=10090 GN=Itih2 PE=1 SV=1
16	P19827	4.99e-101	345	911	0.163	0.235	ITIH1_HUMAN Inter-alpha-trypsin inhibitor heavy chain H1 OS=Homo sapiens OX=9606 GN=ITIH1 PE=1 SV=3
17	Q61702	1.10e-98	339	907	0.161	0.234	ITIH1_MOUSE Inter-alpha-trypsin inhibitor heavy chain H1 OS=Mus musculus OX=10090 GN=Itih1 PE=1 SV=2
18	G4S4A1	2.07e-11	71.2	1205	0.041	0.045	G4S4A1_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=1
19	Q8L798	1.09e-07	58.9	754	0.078	0.135	Q8L798_ARATH Inter-alpha-trypsin inhibitor heavy chain-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g19110 PE=1 SV=1
20	P34374	9.87e-07	55.8	1249	0.043	0.045	UNC36_CAEEL Voltage-dependent calcium channel unc-36 OS=Caenorhabditis elegans OX=6239 GN=unc-36 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06668 ITI_HC_C	2.7e-38	143.0	Inter-alpha-trypsin inhibitor heavy chain C-terminus
2	PF08487 VIT	5.6e-25	99.1	Vault protein inter-alpha-trypsin domain
3	PF00092 VWA	5.7e-16	70.8	von Willebrand factor type A domain
4	PF13519 VWA_2	6.4e-08	44.6	von Willebrand factor type A domain
5	PF13768 VWA_3	3.6e-13	61.2	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000218436

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376930	0.756	Endoplasmic reticulum membrane protein that promotes endoplasmic reticulum-associated endosome fission . Localizes to contact sites between the endoplasmic reticulum and endosomes and acts by promoting recruitment of the endoplasmic reticulum to endosome tubules for fission . Endosome membrane fission of early and late endosomes is essential to separate regions destined for lysosomal degradation from carriers to be recycled to the plasma membrane .
2	9606.ENSP00000405950	0.755	Calcium/calmodulin-dependent protein kinase type 1B
3	9606.ENSP00000290913	0.741	MICOS complex subunit MIC25
4	9606.ENSP00000262570	0.726	MICOS complex subunit MIC19
5	9606.ENSP00000356256	0.720	Mitochondrial import inner membrane translocase subunit Tim17-A
6	9606.ENSP00000368986	0.707	Olfactory receptor 6C65
7	9606.ENSP00000378235	0.598	Scm-like with four MBT domains protein 1
8	9606.ENSP00000379999	0.596	Translocase of inner mitochondrial membrane 17B
9	9606.ENSP00000359788	0.574	Integrator complex subunit 6-like
10	9606.ENSP00000425421	0.572	Spermidine/spermine N1-acetyl transferase like 1
11	9606.ENSP00000266014	0.556	Glycosyltransferase 8 domain containing 1
12	9606.ENSP00000263125	0.530	Protein kinase C theta type
13	9606.ENSP00000256460	0.521	Calcium/calmodulin-dependent protein kinase type 1
14	9606.ENSP00000297866	0.518	Cilia- and flagella-associated protein 47
15	9606.ENSP00000367926	0.518	Cilia- and flagella-associated protein 47
16	9606.ENSP00000367929	0.518	Cilia- and flagella-associated protein 47
17	9606.ENSP00000393163	0.518	Zinc finger protein 630
18	9606.ENSP00000370519	0.517	Arylsulfatase F
19	9606.ENSP00000009105	0.508	Calcium/calmodulin-dependent protein kinase type 1G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.924	cellular process
GO:0071840	0.480	cellular component organization or biogenesis
GO:0016043	0.427	cellular component organization
GO:0065007	0.333	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0071944	0.987	cell periphery
GO:0043226	0.968	organelle
GO:0005622	0.954	intracellular anatomical structure
GO:0043227	0.948	membrane-bounded organelle
GO:0043229	0.941	intracellular organelle
GO:0031974	0.892	membrane-enclosed lumen
GO:0005737	0.881	cytoplasm
GO:0070013	0.831	intracellular organelle lumen
GO:0043231	0.796	intracellular membrane-bounded organelle
GO:0005576	0.774	extracellular region
GO:0016020	0.742	membrane
GO:0030312	0.538	external encapsulating structure
GO:0005615	0.531	extracellular space
GO:0031012	0.509	extracellular matrix
GO:0062023	0.360	collagen-containing extracellular matrix
GO:0012505	0.342	endomembrane system
GO:0031981	0.312	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]