StarFunc result for job id Q6UXY1

User Input

>input (529 residues)
MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGE
RALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQ
HYELEYRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEE
KRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALG
PPYPSGRLTPTCLDMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSA
SSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQ
NGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSR
SYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMG
STAVATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXY1	1.000	1.000	1.425E-72	529	1.000	1.000	Q6UXY1.pdb.gz	BI2L2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2 PE=1 SV=1
2	AFDB:Q9UHR4	0.401	0.415	1.306E-26	511	0.308	0.319	Q9UHR4.pdb.gz	BI2L1_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2
3	AFDB:Q9U2T9	0.150	0.089	1.751E-9	1085	0.200	0.098	Q9U2T9.pdb.gz	Q9U2T9_CAEEL Intersectin-1 OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=2
4	AFDB:A0A0B4KEU9	0.377	0.254	3.649E-9	804	0.198	0.131	A0A0B4KEU9.pdb.gz	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
5	AFDB:E1JGY9	0.378	0.214	8.486E-8	950	0.185	0.103	E1JGY9.pdb.gz	E1JGY9_DROME Missing-in-metastasis, isoform D OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
6	PDB:2dybA	0.104	0.181	1.019E-4	298	0.045	0.081	2dybA.pdb.gz
7	AFDB:A0A1D5P266	0.170	0.142	1.891E-4	682	0.123	0.095	A0A1D5P266.pdb.gz
8	AFDB:P25623	0.248	0.166	2.100E-4	870	0.157	0.095	P25623.pdb.gz	SYP1_YEAST Suppressor of yeast profilin deletion OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYP1 PE=1 SV=3
9	AFDB:P49418	0.179	0.144	3.549E-4	695	0.140	0.106	P49418.pdb.gz	AMPH_HUMAN Amphiphysin OS=Homo sapiens OX=9606 GN=AMPH PE=1 SV=1
10	AFDB:Q7TQF7	0.168	0.137	5.123E-4	686	0.140	0.108	Q7TQF7.pdb.gz	AMPH_MOUSE Amphiphysin OS=Mus musculus OX=10090 GN=Amph PE=1 SV=1
11	AFDB:Q9UBW5	0.200	0.191	5.123E-4	565	0.153	0.143	Q9UBW5.pdb.gz	BIN2_HUMAN Bridging integrator 2 OS=Homo sapiens OX=9606 GN=BIN2 PE=1 SV=3
12	PDB:1k0xA	0.106	0.471	2.924E-3	108	0.025	0.120	1k0xA.pdb.gz
13	PDB:3ehqA	0.105	0.285	2.924E-3	182	0.026	0.077	3ehqA.pdb.gz
14	PDB:1griA	0.109	0.264	6.094E-3	211	0.030	0.076	1griA.pdb.gz
15	PDB:1k9aB	0.103	0.123	7.516E-3	441	0.025	0.029	1k9aB.pdb.gz
16	PDB:2lqnA	0.109	0.185	8.796E-3	303	0.045	0.079	2lqnA.pdb.gz
17	PDB:6q0xA	0.203	0.260	1.566E-2	373	0.057	0.080	6q0xA.pdb.gz
18	PDB:3hajA	0.143	0.239	1.932E-2	286	0.043	0.080	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
19	PDB:4mt6A	0.094	0.127	3.820E-2	389	0.032	0.044	4mt6A.pdb.gz
20	PDB:2h8hA	0.097	0.115	4.025E-2	445	0.025	0.029	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXY1	0.0	1081	529	1.000	1.000	BI2L2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2 PE=1 SV=1
2	Q80Y61	0.0	922	522	0.913	0.925	BI2L2_MOUSE Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Mus musculus OX=10090 GN=Baiap2l2 PE=1 SV=1
3	Q9UHR4	5.32e-69	232	511	0.323	0.335	BI2L1_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2
4	Q6GMN2	1.99e-59	207	535	0.304	0.301	BAIP2_RAT Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Baiap2 PE=1 SV=1
5	Q8BKX1	6.41e-59	206	535	0.301	0.297	BAIP2_MOUSE Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Mus musculus OX=10090 GN=Baiap2 PE=1 SV=2
6	Q9UQB8	1.22e-56	200	552	0.299	0.286	BAIP2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
7	Q60437	7.60e-53	189	521	0.236	0.240	BAIP2_CRIGR Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Cricetulus griseus OX=10029 GN=BAIAP2 PE=1 SV=1
8	I3L4C2	1.12e-50	184	553	0.236	0.226	I3L4C2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
9	I3L3C6	3.80e-18	85.5	216	0.125	0.306	I3L3C6_HUMAN BAR/IMD domain containing adaptor protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
10	B4DWA1	6.18e-18	87.8	375	0.144	0.203	B4DWA1_HUMAN BAR/IMD domain containing adaptor protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
11	Q8IQE6	9.59e-17	86.3	1076	0.093	0.046	Q8IQE6_DROME Insulin receptor substrate 53 kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=2
12	X2JCT5	1.28e-16	85.5	646	0.093	0.076	X2JCT5_DROME Insulin receptor substrate 53 kDa, isoform E OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=1
13	A8JNR3	1.58e-16	85.1	630	0.093	0.078	A8JNR3_DROME Insulin receptor substrate 53 kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=1
14	A8JNR2	1.62e-16	85.1	629	0.093	0.078	A8JNR2_DROME Insulin receptor substrate 53 kDa, isoform D OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=2
15	Q61792	5.39e-08	56.6	263	0.079	0.160	LASP1_MOUSE LIM and SH3 domain protein 1 OS=Mus musculus OX=10090 GN=Lasp1 PE=1 SV=1
16	Q99MZ8	2.03e-07	54.7	263	0.079	0.160	LASP1_RAT LIM and SH3 domain protein 1 OS=Rattus norvegicus OX=10116 GN=Lasp1 PE=1 SV=1
17	Q14847	1.70e-06	52.0	261	0.078	0.157	LASP1_HUMAN LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2
18	Q9UNF0	4.84e-06	51.6	486	0.142	0.154	PACN2_HUMAN Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2
19	M9PBF6	1.21e-05	50.8	1088	0.051	0.025	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
20	Q9VIF7	1.21e-05	50.8	1097	0.051	0.025	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16746 BAR_3	0.42	21.7	BAR domain of APPL family
2	PF18937 DUF5685	64	14.4	Family of unknown function (DUF5685)
3	PF08397 IMD	7.5e-91	315.0	IRSp53/MIM homology domain
4	PF05478 Prominin	6.3e+02	9.8	Prominin
5	PF08824 Serine_rich	2.2e+02	13.3	Serine rich protein interaction domain
6	PF00018 SH3_1	3.7	18.6	SH3 domain
7	PF07653 SH3_2	0.012	26.8	Variant SH3 domain
8	PF14604 SH3_9	1.4e-05	36.3	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309415	0.727	Clathrin light chain B
2	9606.ENSP00000336666	0.727	AP-1 complex subunit sigma-1A
3	9606.ENSP00000327694	0.726	AP-2 complex subunit alpha-2
4	9606.ENSP00000351926	0.726	AP-2 complex subunit alpha-1
5	9606.ENSP00000483453	0.724	Synergin gamma
6	9606.ENSP00000292807	0.723	AP-2 complex subunit mu
7	9606.ENSP00000345055	0.722	Potassium voltage-gated channel subfamily KQT member 5
8	9606.ENSP00000238855	0.720	Aftiphilin
9	9606.ENSP00000242285	0.720	Clathrin light chain A
10	9606.ENSP00000263270	0.720	AP-2 complex subunit sigma
11	9606.ENSP00000302108	0.720	Pantothenate kinase 1
12	9606.ENSP00000360076	0.720	SH3-containing GRB2-like protein 3-interacting protein 1
13	9606.ENSP00000379256	0.720	Neurocalcin-delta
14	9606.ENSP00000391942	0.720	Adaptin ear-binding coat-associated protein 2
15	9606.ENSP00000479606	0.720	Clathrin heavy chain 1
16	9606.ENSP00000482835	0.720	AP-2 complex subunit beta
17	9606.ENSP00000341171	0.684	MTSS1-like protein
18	9606.ENSP00000355210	0.643	Transmembrane protein 184B
19	9606.ENSP00000348602	0.601	Amphiphysin
20	9606.ENSP00000360798	0.572	Epidermal growth factor receptor substrate 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005543	0.997	phospholipid binding
GO:0042802	0.995	identical protein binding
GO:0042803	0.347	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.986	cellular component organization
GO:0061024	0.898	membrane organization
GO:0065007	0.683	biological regulation
GO:0050794	0.619	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0043227	0.998	membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0032991	0.994	protein-containing complex
GO:0031982	0.993	vesicle
GO:0030054	0.983	cell junction
GO:0043229	0.983	intracellular organelle
GO:0048475	0.978	coated membrane
GO:0098796	0.974	membrane protein complex
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0031090	0.964	organelle membrane
GO:0030118	0.964	clathrin coat
GO:0071944	0.956	cell periphery
GO:0012505	0.953	endomembrane system
GO:0005886	0.952	plasma membrane
GO:0012506	0.911	vesicle membrane
GO:0070161	0.794	anchoring junction
GO:0031410	0.778	cytoplasmic vesicle
GO:0005911	0.665	cell-cell junction
GO:0030659	0.656	cytoplasmic vesicle membrane
GO:0071439	0.495	clathrin complex
GO:0044291	0.446	cell-cell contact zone
GO:0098588	0.400	bounding membrane of organelle
GO:0005634	0.336	nucleus
GO:0005654	0.303	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]