StarFunc result for job id Q6UXZ3

User Input

>input (194 residues)
MWLSPSLLLLILPGYSIAAKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNY
CNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKV
QVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSM
LGTVLWVNRPQRRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UXZ3	1.000	1.000	5.217E-36	194	1.000	1.000	Q6UXZ3.pdb.gz	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
2	AFDB:Q6SJQ5	0.586	0.467	1.496E-22	245	0.510	0.404	Q6SJQ5.pdb.gz	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
3	AFDB:Q8VCH2	0.582	0.513	9.573E-22	221	0.510	0.448	Q8VCH2.pdb.gz	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
4	AFDB:Q8TDQ1	0.577	0.390	2.490E-21	290	0.510	0.341	Q8TDQ1.pdb.gz	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
5	AFDB:Q3U497	0.578	0.539	1.272E-20	209	0.423	0.392	Q3U497.pdb.gz	CLM7_MOUSE CMRF35-like molecule 7 OS=Mus musculus OX=10090 GN=Cd300lb PE=1 SV=2
6	AFDB:A8K4G0	0.589	0.569	1.783E-20	201	0.443	0.428	A8K4G0.pdb.gz	CLM7_HUMAN CMRF35-like molecule 7 OS=Homo sapiens OX=9606 GN=CD300LB PE=1 SV=2
7	AFDB:Q496F6	0.572	0.546	1.144E-18	205	0.428	0.405	Q496F6.pdb.gz	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
8	AFDB:Q6SJQ7	0.586	0.342	3.943E-18	337	0.412	0.237	Q6SJQ7.pdb.gz	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
9	AFDB:Q08708	0.587	0.518	3.158E-17	224	0.454	0.393	Q08708.pdb.gz	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
10	AFDB:Q7TSN2	0.603	0.517	5.543E-17	228	0.371	0.316	Q7TSN2.pdb.gz	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
11	PDB:1cd0A	0.462	0.770	7.201E-8	111	0.088	0.153	1cd0A.pdb.gz
12	PDB:5ir3A	0.445	0.739	9.018E-8	111	0.108	0.189	5ir3A.pdb.gz
13	PDB:3zhlA	0.429	0.653	1.674E-7	121	0.129	0.207	3zhlA.pdb.gz
14	PDB:2cd0A	0.454	0.749	2.218E-7	111	0.103	0.180	2cd0A.pdb.gz
15	PDB:1bd2D	0.490	0.499	3.892E-7	190	0.082	0.084	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.
16	PDB:3oaiA	0.450	0.190	5.769E-7	488	0.098	0.039	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
17	PDB:6xdsA	0.447	0.189	6.103E-7	485	0.139	0.056	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.
18	PDB:4aizA	0.433	0.745	9.570E-7	107	0.072	0.131	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
19	PDB:1f6lL	0.436	0.750	1.071E-6	106	0.098	0.179	1f6lL.pdb.gz
20	PDB:2jb5L	0.439	0.406	1.268E-6	211	0.113	0.104	2jb5L.pdb.gz	Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UXZ3	5.04e-144	400	194	1.000	1.000	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
2	Q8VCH2	4.41e-57	181	221	0.521	0.457	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
3	Q8TDQ1	2.72e-55	179	290	0.428	0.286	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
4	Q3U497	9.99e-53	169	209	0.443	0.411	CLM7_MOUSE CMRF35-like molecule 7 OS=Mus musculus OX=10090 GN=Cd300lb PE=1 SV=2
5	A8K4G0	4.23e-52	167	201	0.402	0.388	CLM7_HUMAN CMRF35-like molecule 7 OS=Homo sapiens OX=9606 GN=CD300LB PE=1 SV=2
6	Q6SJQ5	1.67e-50	165	245	0.505	0.400	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
7	Q6SJQ7	2.48e-38	136	337	0.325	0.187	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
8	Q7TSN2	4.81e-30	112	228	0.392	0.333	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
9	Q08708	4.33e-28	107	224	0.474	0.411	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
10	Q496F6	1.53e-21	89.4	205	0.387	0.366	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
11	A0A0K2S4Q6	2.19e-20	86.3	201	0.397	0.383	CD3CH_HUMAN Protein CD300H OS=Homo sapiens OX=9606 GN=CD300H PE=1 SV=1
12	Q9UGN4	2.38e-17	80.1	299	0.253	0.164	CLM8_HUMAN CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A PE=1 SV=2
13	Q1ERP8	4.29e-15	74.3	331	0.222	0.130	CLM9_MOUSE CMRF35-like molecule 9 OS=Mus musculus OX=10090 GN=Cd300lg PE=1 SV=1
14	Q6UXG3	1.84e-12	66.6	332	0.186	0.108	CLM9_HUMAN CMRF35-like molecule 9 OS=Homo sapiens OX=9606 GN=CD300LG PE=1 SV=2
15	Q6SJQ0	2.29e-12	66.2	318	0.253	0.154	CLM8_MOUSE CMRF35-like molecule 8 OS=Mus musculus OX=10090 GN=Cd300a PE=1 SV=2
16	O95944	3.68e-08	53.9	276	0.232	0.163	NCTR2_HUMAN Natural cytotoxicity triggering receptor 2 OS=Homo sapiens OX=9606 GN=NCR2 PE=1 SV=2
17	Q3LRV9	1.69e-07	52.0	263	0.201	0.148	TRML4_MOUSE Trem-like transcript 4 protein OS=Mus musculus OX=10090 GN=Treml4 PE=1 SV=1
18	P15083	1.76e-07	52.8	769	0.191	0.048	PIGR_RAT Polymeric immunoglobulin receptor OS=Rattus norvegicus OX=10116 GN=Pigr PE=1 SV=1
19	P01833	3.03e-07	52.0	764	0.222	0.056	PIGR_HUMAN Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4
20	P01832	9.48e-06	47.8	773	0.222	0.056	PIGR_RABIT Polymeric immunoglobulin receptor OS=Oryctolagus cuniculus OX=9986 GN=PIGR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	87	14.7	Immunoglobulin domain
2	PF13927 Ig_3	1.7e+02	14.2	Immunoglobulin domain
3	PF07686 V-set	8.5e-10	50.2	Immunoglobulin V-set domain
4	PF15910 V-set_2	3.8e+02	12.6	ICOS V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364501

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000435325	0.651	Nuclear pore complex interacting protein family member A8
2	9606.ENSP00000244709	0.617	Triggering receptor expressed on myeloid cells 1
3	9606.ENSP00000362205	0.558	Triggering receptor expressed on myeloid cells 2
4	9606.ENSP00000418767	0.503	Trem-like transcript 2 protein
5	9606.ENSP00000362181	0.501	Natural cytotoxicity triggering receptor 2
6	9606.ENSP00000402855	0.501	Trem-like transcript 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.478	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.986	regulation of cellular process
GO:0051239	0.980	regulation of multicellular organismal process
GO:0050896	0.976	response to stimulus
GO:0009987	0.972	cellular process
GO:0048518	0.970	positive regulation of biological process
GO:0002682	0.965	regulation of immune system process
GO:0051716	0.792	cellular response to stimulus
GO:0002376	0.741	immune system process
GO:0019222	0.618	regulation of metabolic process
GO:0048583	0.616	regulation of response to stimulus
GO:0060255	0.601	regulation of macromolecule metabolic process
GO:0007165	0.574	signal transduction
GO:0050865	0.564	regulation of cell activation
GO:0002684	0.549	positive regulation of immune system process
GO:0010468	0.492	regulation of gene expression
GO:0031347	0.489	regulation of defense response
GO:0002694	0.468	regulation of leukocyte activation
GO:0032101	0.463	regulation of response to external stimulus
GO:0031349	0.463	positive regulation of defense response
GO:0023051	0.452	regulation of signaling
GO:0010646	0.452	regulation of cell communication
GO:0045088	0.441	regulation of innate immune response
GO:0001817	0.435	regulation of cytokine production
GO:0009966	0.432	regulation of signal transduction
GO:0032103	0.418	positive regulation of response to external stimulus
GO:0048522	0.417	positive regulation of cellular process
GO:0006950	0.318	response to stress
GO:0050778	0.301	positive regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]