StarFunc result for job id Q6UY14

User Input

>input (1074 residues)
MENWTGRPWLYLLLLLSLPQLCLDQEVLSGHSLQTPTEEGQGPEGVWGPWVQWASCSQPC
GVGVQRRSRTCQLPTVQLHPSLPLPPRPPRHPEALLPRGQGPRPQTSPETLPLYRTQSRG
RGGPLRGPASHLGREETQEIRAARRSRLRDPIKPGMFGYGRVPFALPLHRNRRHPRSPPR
SELSLISSRGEEAIPSPTPRAEPFSANGSPQTELPPTELSVHTPSPQAEPLSPETAQTEV
APRTRPAPLRHHPRAQASGTEPPSPTHSLGEGGFFRASPQPRRPSSQGWASPQVAGRRPD
PFPSVPRGRGQQGQGPWGTGGTPHGPRLEPDPQHPGAWLPLLSNGPHASSLWSLFAPSSP
IPRCSGESEQLRACSQAPCPPEQPDPRALQCAAFNSQEFMGQLYQWEPFTEVQGSQRCEL
NCRPRGFRFYVRHTEKVQDGTLCQPGAPDICVAGRCLSPGCDGILGSGRRPDGCGVCGGD
DSTCRLVSGNLTDRGGPLGYQKILWIPAGALRLQIAQLRPSSNYLALRGPGGRSIINGNW
AVDPPGSYRAGGTVFRYNRPPREEGKGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVIS
SPPPILENPTPEPPVPQLQPEILRVEPPLAPAPRPARTPGTLQRQVRIPQMPAPPHPRTP
LGSPAAYWKRVGHSACSASCGKGVWRPIFLCISRESGEELDERSCAAGARPPASPEPCHG
TPCPPYWEAGEWTSCSRSCGPGTQHRQLQCRQEFGGGGSSVPPERCGHLPRPNITQSCQL
RLCGHWEVGSPWSQCSVRCGRGQRSRQVRCVGNNGDEVSEQECASGPPQPPSREACDMGP
CTTAWFHSDWSSKCSAECGTGIQRRSVVCLGSGAALGPGQGEAGAGTGQSCPTGSRPPDM
RACSLGPCERTWRWYTGPWGECSSECGSGTQRRDIICVSKLGTEFNVTSPSNCSHLPRPP
ALQPCQGQACQDRWFSTPWSPCSRSCQGGTQTREVQCLSTNQTLSTRCPPQLRPSRKRPC
NSQPCSQRPDDQCKDSSPHCPLVVQARLCVYPYYTATCCRSCAHVLERSPQDPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UY14	1.000	1.000	0.000	1074	1.000	1.000	Q6UY14.pdb.gz	ATL4_HUMAN ADAMTS-like protein 4 OS=Homo sapiens OX=9606 GN=ADAMTSL4 PE=1 SV=2
2	AFDB:Q8TE60	0.166	0.148	1.240E-59	1221	0.198	0.174	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
3	AFDB:Q69Z28	0.169	0.151	1.367E-58	1222	0.188	0.165	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
4	AFDB:Q4VC17	0.165	0.148	1.756E-57	1219	0.196	0.173	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
5	PDB:1w0rA	0.072	0.138	9.227E-12	442	0.076	0.186	1w0rA.pdb.gz
6	PDB:4a5wB	0.053	0.064	5.324E-4	871	0.026	0.032	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
7	PDB:3t5oA	0.045	0.053	7.611E-4	871	0.027	0.033	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
8	AFDB:B7YZW3	0.069	0.044	1.416E-3	2064	0.121	0.063	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
9	AFDB:P08640	0.040	0.035	4.137E-3	1367	0.142	0.112	P08640.pdb.gz	FLO11_YEAST Flocculation protein FLO11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLO11 PE=1 SV=2
10	PDB:2rcjC	0.057	0.102	7.573E-3	523	0.051	0.105	2rcjC.pdb.gz
11	PDB:4e0sB	0.045	0.053	7.573E-3	898	0.025	0.030	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
12	PDB:5a42A	0.044	0.034	7.573E-3	1597	0.043	0.029	5a42A.pdb.gz
13	PDB:2n6fA	0.043	0.183	1.398E-2	136	0.019	0.147	2n6fA.pdb.gz
14	PDB:4aq1A	0.041	0.055	2.213E-2	721	0.042	0.062	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
15	AFDB:A0A494C1M0	0.036	0.038	2.736E-2	1011	0.142	0.151	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
16	PDB:6y0fC	0.032	0.045	3.329E-2	722	0.033	0.048	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
17	PDB:4rtdA	0.038	0.037	3.880E-2	1122	0.047	0.045	4rtdA.pdb.gz
18	AFDB:E9Q4Y4	0.040	0.022	3.912E-2	2514	0.123	0.053	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
19	AFDB:A0A0U1RQE4	0.038	0.039	5.593E-2	1047	0.141	0.144	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
20	AFDB:W5U9R6	0.062	0.073	9.807E-2	879	0.110	0.134	W5U9R6.pdb.gz	W5U9R6_ICTPU Nuclear factor of activated T-cells, cytoplasmic 1 OS=Ictalurus punctatus OX=7998 GN=NFATC1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UTY6	0.0	644	1018	0.304	0.321	THSD4_MOUSE Thrombospondin type-1 domain-containing protein 4 OS=Mus musculus OX=10090 GN=Thsd4 PE=1 SV=2
2	Q6UY14	0.0	2117	1074	1.000	1.000	ATL4_HUMAN ADAMTS-like protein 4 OS=Homo sapiens OX=9606 GN=ADAMTSL4 PE=1 SV=2
3	Q6ZMP0	0.0	644	1018	0.305	0.322	THSD4_HUMAN Thrombospondin type-1 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=THSD4 PE=1 SV=2
4	Q80T21	0.0	1447	1036	0.755	0.783	ATL4_MOUSE ADAMTS-like protein 4 OS=Mus musculus OX=10090 GN=Adamtsl4 PE=2 SV=1
5	Q8TE60	9.63e-87	307	1221	0.184	0.162	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
6	Q868Z9	1.22e-83	301	2898	0.197	0.073	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
7	Q4VC17	1.87e-81	291	1219	0.193	0.170	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
8	Q9VKV3	1.31e-77	275	880	0.199	0.243	Q9VKV3_DROME Lonely heart, isoform A OS=Drosophila melanogaster OX=7227 GN=loh PE=4 SV=3
9	Q69Z28	3.01e-77	279	1222	0.173	0.152	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
10	Q8MSF8	1.11e-76	273	880	0.199	0.243	Q8MSF8_DROME GM15606p OS=Drosophila melanogaster OX=7227 GN=loh PE=2 SV=1
11	E1JHE3	6.47e-76	271	879	0.198	0.242	E1JHE3_DROME Lonely heart, isoform D OS=Drosophila melanogaster OX=7227 GN=loh PE=4 SV=2
12	E7FFX0	1.88e-74	271	1224	0.159	0.140	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
13	D3ZLL7	1.80e-73	268	1221	0.168	0.147	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
14	D3Z1A5	9.53e-73	265	1117	0.163	0.157	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
15	P59510	6.88e-72	265	1910	0.188	0.106	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
16	P59511	1.50e-71	264	1906	0.201	0.113	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
17	O76840	3.39e-69	256	2167	0.174	0.086	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
18	E9PUN6	1.72e-68	254	1931	0.204	0.113	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
19	E7FEJ5	2.14e-68	253	1244	0.167	0.144	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
20	Q9P2N4	3.78e-68	253	1935	0.202	0.112	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19236 ADAMTS_CR_3	1e-05	36.9	ADAMTS cysteine-rich domain
2	PF05986 ADAMTS_spacer1	1.5e-19	81.8	ADAM-TS Spacer 1
3	PF08686 PLAC	1.1e-06	40.6	PLAC (protease and lacunin) domain
4	PF19030 TSP1_ADAMTS	5.8e-63	220.3	Thrombospondin type 1 domain
5	PF19035 TSP1_CCN	0.00049	31.7	CCN3 Nov like TSP1 domain
6	PF19028 TSP1_spondin	4.5e-05	35.0	Spondin-like TSP1 domain
7	PF00090 TSP_1	2.4e-23	93.4	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358035

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343002	0.973	Beta-1,3-glucosyltransferase
2	9606.ENSP00000339613	0.947	GDP-fucose protein O-fucosyltransferase 2
3	9606.ENSP00000247153	0.939	Properdin
4	9606.ENSP00000268070	0.935	ADAM metallopeptidase with thrombospondin type 1 motif 17
5	9606.ENSP00000270328	0.934	A disintegrin and metalloproteinase with thrombospondin motifs 10
6	9606.ENSP00000346478	0.930	ADAMTS-like protein 2
7	9606.ENSP00000369921	0.930	ADAMTS-like protein 1
8	9606.ENSP00000251582	0.929	A disintegrin and metalloproteinase with thrombospondin motifs 2
9	9606.ENSP00000327608	0.926	ADAMTS-like protein 5
10	9606.ENSP00000374071	0.925	A disintegrin and metalloproteinase with thrombospondin motifs 20
11	9606.ENSP00000370443	0.921	ADAM metallopeptidase with thrombospondin type 1 motif 6
12	9606.ENSP00000418735	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 9
13	9606.ENSP00000286744	0.919	ADAMTS-like protein 3
14	9606.ENSP00000360997	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 13
15	9606.ENSP00000373472	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 7
16	9606.ENSP00000284984	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 1
17	9606.ENSP00000284987	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 5
18	9606.ENSP00000356975	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 4
19	9606.ENSP00000362304	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 14
20	9606.ENSP00000282849	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0002020	1.000	protease binding
GO:0003824	0.694	catalytic activity
GO:0016787	0.610	hydrolase activity
GO:0140096	0.542	catalytic activity, acting on a protein
GO:0008233	0.501	peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.962	regulation of biological process
GO:0050794	0.950	regulation of cellular process
GO:0009987	0.930	cellular process
GO:0048518	0.697	positive regulation of biological process
GO:0048522	0.626	positive regulation of cellular process
GO:0032502	0.450	developmental process
GO:0010941	0.432	regulation of cell death
GO:0010942	0.421	positive regulation of cell death
GO:0008152	0.338	metabolic process
GO:0071840	0.338	cellular component organization or biogenesis
GO:0071704	0.333	organic substance metabolic process
GO:0048856	0.323	anatomical structure development
GO:0016043	0.310	cellular component organization
GO:0050896	0.306	response to stimulus
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0070013	0.999	intracellular organelle lumen
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0005737	0.995	cytoplasm
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005783	0.957	endoplasmic reticulum
GO:0005788	0.948	endoplasmic reticulum lumen
GO:0005576	0.451	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.610	Hydrolases.
EC:3.4.-.-	0.501	Acting on peptide bonds (peptidases).

[back to server]