StarFunc result for job id Q6V0I7

User Input

>input (1400 residues)
MDLAPDRATGRPWLPLHTLSVSQLLRVFWLLSLLPGQAWVHGAEPRQVFQVLEEQPPGTL
VGTIQTRPGFTYRLSESHALFAINSSTGALYTTSTIDRESLPSDVINLVVLSSAPTYPTE
VRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGN
EAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTV
QDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDP
ETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPA
TSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLI
KVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVY
RVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGL
DRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGT
ELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVL
ATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGT
NGTVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVT
ITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFA
INQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESV
NVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHAG
SYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQA
SDKDSGANGEIAYTIAEGNTGDAFGIFPDGQLYIKSELDRELQDRYVLMVVASDRAVEPL
SATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFE
MVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYM
KDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAI
DSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTL
FVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDF
ETQSLYKLNITAKDQGRPPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VFH5	0.251	0.182	2.524E-89	1981	0.290	0.205	Q9VFH5.pdb.gz	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
2	AFDB:Q9VVG0	0.171	0.140	1.263E-88	1820	0.279	0.214	Q9VVG0.pdb.gz	Q9VVG0_DROME Cadherin 74A, isoform A OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
3	AFDB:A0A0R4IZF0	0.143	0.106	9.391E-82	1907	0.244	0.179	A0A0R4IZF0.pdb.gz
4	AFDB:Q9VAF5	0.182	0.153	4.460E-79	1706	0.222	0.182	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
5	AFDB:Q99PJ1	0.141	0.103	7.065E-79	1943	0.240	0.173	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
6	AFDB:Q5ICW6	0.129	0.105	8.420E-76	1796	0.235	0.183	Q5ICW6.pdb.gz	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
7	AFDB:Q0ZM14	0.145	0.111	1.009E-74	1899	0.243	0.179	Q0ZM14.pdb.gz	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
8	AFDB:Q96QU1	0.138	0.101	7.950E-72	1955	0.229	0.164	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
9	AFDB:G5EDK5	0.159	0.094	1.659E-71	2596	0.195	0.105	G5EDK5.pdb.gz	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
10	AFDB:Q08174	0.396	0.506	1.889E-68	1060	0.183	0.242	Q08174.pdb.gz	PCDH1_HUMAN Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2
11	PDB:7sqcO0	0.081	0.092	2.179E-17	1140	0.074	0.090	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.082	0.135	2.719E-14	721	0.060	0.117	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:6velC	0.128	0.796	6.204E-13	209	0.043	0.287	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
14	PDB:5oj2B	0.103	0.181	1.871E-12	692	0.076	0.153	5oj2B.pdb.gz
15	PDB:1e07A	0.121	0.198	4.470E-11	642	0.061	0.134	1e07A.pdb.gz
16	PDB:5a42A	0.063	0.058	1.548E-10	1597	0.111	0.098	5a42A.pdb.gz
17	PDB:7q1yA	0.100	0.101	5.610E-10	1374	0.072	0.074	7q1yA.pdb.gz
18	PDB:7vonA	0.075	0.075	1.226E-9	1399	0.069	0.069	7vonA.pdb.gz
19	PDB:7q5zA	0.077	0.080	1.474E-9	1344	0.070	0.073	7q5zA.pdb.gz
20	PDB:7nycA	0.069	0.064	6.133E-9	1542	0.074	0.067	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PVD3	0.0	607	3291	0.330	0.140	PCD16_MOUSE Protocadherin-16 OS=Mus musculus OX=10090 GN=Dchs1 PE=1 SV=1
2	P33450	0.0	954	5147	0.416	0.113	FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster OX=7227 GN=ft PE=1 SV=3
3	Q24292	0.0	737	3503	0.356	0.142	DS_DROME Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3
4	Q2PZL6	0.0	2617	4981	0.914	0.257	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
5	Q6V0I7	0.0	2841	4981	1.000	0.281	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
6	Q96JQ0	0.0	629	3298	0.338	0.143	PCD16_HUMAN Protocadherin-16 OS=Homo sapiens OX=9606 GN=DCHS1 PE=1 SV=1
7	X2J8E9	0.0	737	3556	0.356	0.140	X2J8E9_DROME Dachsous, isoform B OS=Drosophila melanogaster OX=7227 GN=ds PE=4 SV=1
8	Q6QQE1	4.71e-171	571	3366	0.342	0.142	Q6QQE1_DANRE Cadherin 23 OS=Danio rerio OX=7955 GN=cdh23 PE=1 SV=1
9	Q99PF4	1.05e-167	561	3354	0.329	0.137	CAD23_MOUSE Cadherin-23 OS=Mus musculus OX=10090 GN=Cdh23 PE=1 SV=2
10	P58365	2.18e-166	557	3317	0.329	0.139	CAD23_RAT Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23 PE=2 SV=1
11	A0A0A6YW72	5.61e-166	556	3346	0.325	0.136	A0A0A6YW72_MOUSE Dachsous cadherin related 2 OS=Mus musculus OX=10090 GN=Dchs2 PE=4 SV=1
12	Q9H251	1.56e-164	551	3354	0.326	0.136	CAD23_HUMAN Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 SV=2
13	Q14517	5.40e-159	535	4588	0.309	0.094	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
14	Q9WU10	4.29e-151	512	4589	0.305	0.093	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
15	Q9QXA3	2.05e-150	509	4587	0.308	0.094	Q9QXA3_MOUSE Fat 1 cadherin (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
16	F2Z4A3	2.89e-150	509	4590	0.308	0.094	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
17	A0A087WRT4	3.09e-150	509	4602	0.308	0.094	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
18	A0A1L1SQU7	4.18e-150	509	4645	0.308	0.093	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
19	A2BGT8	3.26e-146	497	4611	0.306	0.093	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1
20	A0A2R8QAL3	8.66e-145	493	4601	0.294	0.089	A0A2R8QAL3_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	1.8e-250	821.7	Cadherin domain
2	PF08266 Cadherin_2	2e-24	96.6	Cadherin-like
3	PF16184 Cadherin_3	3.5e-14	64.0	Cadherin-like
4	PF17803 Cadherin_4	1.7e+02	14.2	Bacterial cadherin-like domain
5	PF18957 RibLong	0.48	22.6	Long Rib domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377862

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400223	0.894	Four-jointed box protein 1
2	9606.ENSP00000439807	0.877	Multiple PDZ domain protein
3	9606.ENSP00000357040	0.848	Vang-like protein 2
4	9606.ENSP00000363068	0.735	Protocadherin-15
5	9606.ENSP00000262457	0.704	Inversin
6	9606.ENSP00000258341	0.691	Laminin subunit gamma-1
7	9606.ENSP00000343899	0.674	FERM domain containing 6
8	9606.ENSP00000478927	0.633	Transcriptional coactivator YAP1
9	9606.ENSP00000360985	0.620	Brefeldin A-inhibited guanine nucleotide-exchange protein 2
10	9606.ENSP00000406229	0.610	Protocadherin Fat 1
11	9606.ENSP00000290015	0.605	Protein Wnt-9b
12	9606.ENSP00000437550	0.602	Serine/threonine-protein kinase LATS1
13	9606.ENSP00000423333	0.596	Ubiquitin carboxyl-terminal hydrolase 51
14	9606.ENSP00000344456	0.581	Catenin beta-1
15	9606.ENSP00000427772	0.573	Protein KIBRA
16	9606.ENSP00000432586	0.573	Protocadherin Fat 3
17	9606.ENSP00000263925	0.562	E3 ubiquitin-protein ligase LNX
18	9606.ENSP00000349486	0.538	Protein scribble homolog
19	9606.ENSP00000347672	0.527	VANGL planar cell polarity protein 1
20	9606.ENSP00000262189	0.526	Histone-lysine N-methyltransferase 2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0048856	0.848	anatomical structure development
GO:0032501	0.804	multicellular organismal process
GO:0007275	0.791	multicellular organism development
GO:0048731	0.736	system development
GO:0065007	0.732	biological regulation
GO:0072001	0.624	renal system development
GO:0060429	0.575	epithelium development
GO:0048513	0.535	animal organ development
GO:0007155	0.384	cell adhesion
GO:0023052	0.366	signaling
GO:0007399	0.365	nervous system development
GO:0050789	0.357	regulation of biological process
GO:0098609	0.318	cell-cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0043226	0.988	organelle
GO:0043227	0.961	membrane-bounded organelle
GO:0016020	0.928	membrane
GO:0005886	0.862	plasma membrane
GO:0005576	0.434	extracellular region
GO:0031982	0.379	vesicle
GO:0005615	0.343	extracellular space
GO:0070062	0.310	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]