StarFunc result for job id Q6V1P9

User Input

>input (1400 residues)
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAAS
GSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHP
DTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSS
SPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVLDENDNPPVFEQDE
YRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTE
GGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGELGVGLGDGSISLSLEGGEGDFAL
LPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTA
ECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDVNDNE
PIFWRQVYNATIAEHAPVGHCFLQVTASDADSGLYGFIEYSLYDGFLSYEAPQAFRIDPH
DGQICVSQDIDRERDPATYDLLVEAKDGGGLSAQAFVRVDLEDVNDNHPVFNPSTYVTSI
SDETQPGTEIINVLATDQDSGIYGTVAYELIPGNVSSLFTIDSTTGIIYLTLPLSHLEST
TLSLMVSAQDGGGLTAVINADVTIHIFQTTLAPAEFERPKYTFLVYEDVPEDSPIGTVKA
REPLNSSEPIFYRISSGDLGGKFSIHPRLGTIRTRKPLDHETQPVVVLTVQAQLGSAPAC
SSTEVNITVMDVNDNHPAFLRTSDEIRISQTTPPGTALYLARAEDRDSGRNGLIRYSIAS
PQPGVFAIDRALGVLFLNGSLGAGEQRELTLTLRAEDQGVHPQAALLVLTVVIEKREHSP
SWTFEHLVYQVEVSESLSPMTQMLQTQAHPLGPQRAASPLRYSLEPSVDSAMFGIRPYTG
WIYLRRQFDYESTQTYNFRVFAWIPEDGFLQNVSTTVIVRVWDENDNSPTFLHDVLFLKV
EESPVPQGVIGKITAIDMDSGKNGQLLYFLLSDGKFFKMNPNTGELINWVALDREHRGHH
EMTVLVTDRGSPPRNATMAVYVSVTDINDNRPFFPQCLPGKELHVKVLEGQPVNMLVTTV
FAKDPDEGNNAEVTYSVSSEDSSDHFKIDANNGEIRTTTILSYDYRPSYRMSVIATDQGV
PPLQGQAVVNIQVIPLSKGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VVG0	0.147	0.116	1.443E-79	1820	0.241	0.185	Q9VVG0.pdb.gz	Q9VVG0_DROME Cadherin 74A, isoform A OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
2	AFDB:Q9VFH5	0.156	0.114	1.063E-77	1981	0.249	0.176	Q9VFH5.pdb.gz	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
3	AFDB:A0A0R4IZF0	0.145	0.116	1.938E-77	1907	0.225	0.165	A0A0R4IZF0.pdb.gz
4	AFDB:Q9VAF5	0.170	0.143	5.662E-76	1706	0.216	0.178	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
5	AFDB:Q99PJ1	0.151	0.116	1.717E-75	1943	0.217	0.156	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
6	AFDB:Q5ICW6	0.145	0.115	4.972E-75	1796	0.215	0.168	Q5ICW6.pdb.gz	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
7	AFDB:Q0ZM14	0.160	0.123	1.321E-68	1899	0.211	0.156	Q0ZM14.pdb.gz	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
8	AFDB:Q96QU1	0.134	0.098	6.075E-68	1955	0.203	0.145	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
9	AFDB:G5EDK5	0.218	0.127	4.644E-67	2596	0.196	0.106	G5EDK5.pdb.gz	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
10	AFDB:Q9BZA7	0.269	0.278	2.496E-64	1347	0.167	0.174	Q9BZA7.pdb.gz	PC11X_HUMAN Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1
11	PDB:7sqcO0	0.120	0.139	1.326E-17	1140	0.081	0.100	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.093	0.149	1.578E-13	721	0.064	0.123	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:6velC	0.129	0.780	5.497E-13	209	0.040	0.268	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
14	PDB:5a42A	0.064	0.059	1.829E-12	1597	0.096	0.085	5a42A.pdb.gz
15	PDB:5oj2B	0.098	0.163	3.831E-12	692	0.066	0.133	5oj2B.pdb.gz
16	PDB:1e07A	0.115	0.194	3.364E-11	642	0.046	0.100	1e07A.pdb.gz
17	PDB:7q1yA	0.083	0.084	3.690E-11	1374	0.068	0.069	7q1yA.pdb.gz
18	PDB:7q5zA	0.103	0.106	4.239E-11	1344	0.078	0.081	7q5zA.pdb.gz
19	PDB:6h03A	0.075	0.083	4.691E-10	1223	0.069	0.078	6h03A.pdb.gz
20	PDB:7vonA	0.074	0.074	8.169E-10	1399	0.083	0.083	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YW72	0.0	2117	3346	0.784	0.328	A0A0A6YW72_MOUSE Dachsous cadherin related 2 OS=Mus musculus OX=10090 GN=Dchs2 PE=4 SV=1
2	E9PVD3	0.0	822	3291	0.374	0.159	PCD16_MOUSE Protocadherin-16 OS=Mus musculus OX=10090 GN=Dchs1 PE=1 SV=1
3	Q24292	0.0	720	3503	0.341	0.136	DS_DROME Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3
4	Q96JQ0	0.0	818	3298	0.371	0.157	PCD16_HUMAN Protocadherin-16 OS=Homo sapiens OX=9606 GN=DCHS1 PE=1 SV=1
5	X2J8E9	0.0	720	3556	0.341	0.134	X2J8E9_DROME Dachsous, isoform B OS=Drosophila melanogaster OX=7227 GN=ds PE=4 SV=1
6	Q6V0I7	1.21e-152	516	4981	0.316	0.089	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
7	Q2PZL6	6.04e-144	490	4981	0.311	0.087	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
8	P33450	3.11e-122	425	5147	0.289	0.079	FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster OX=7227 GN=ft PE=1 SV=3
9	Q9NYQ8	5.79e-116	406	4349	0.276	0.089	FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2
10	A2BGT8	3.12e-114	401	4611	0.280	0.085	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1
11	Q99PF4	2.81e-104	370	3354	0.283	0.118	CAD23_MOUSE Cadherin-23 OS=Mus musculus OX=10090 GN=Cdh23 PE=1 SV=2
12	O88277	7.79e-104	369	4351	0.271	0.087	FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus OX=10116 GN=Fat2 PE=1 SV=1
13	Q6QQE1	1.41e-103	368	3366	0.284	0.118	Q6QQE1_DANRE Cadherin 23 OS=Danio rerio OX=7955 GN=cdh23 PE=1 SV=1
14	P58365	2.66e-103	367	3317	0.283	0.119	CAD23_RAT Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23 PE=2 SV=1
15	Q9VW71	2.82e-102	364	4699	0.254	0.076	FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster OX=7227 GN=kug PE=2 SV=3
16	Q9H251	3.96e-100	357	3354	0.269	0.112	CAD23_HUMAN Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 SV=2
17	F1QA09	8.68e-98	350	4546	0.256	0.079	F1QA09_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=2
18	X1WCY4	1.70e-97	350	4578	0.256	0.078	X1WCY4_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
19	Q14517	6.19e-97	348	4588	0.269	0.082	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
20	Q8BNA6	4.38e-96	345	4555	0.267	0.082	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	1.8e-169	562.1	Cadherin domain
2	PF08266 Cadherin_2	0.00061	30.9	Cadherin-like
3	PF08758 Cadherin_pro	18	16.9	Cadherin prodomain like
4	PF10839 DUF2647	46	15.5	Protein of unknown function (DUF2647)
5	PF03413 PepSY	0.12	24.2	Peptidase propeptide and YPEB domain
6	PF07495 Y_Y_Y	4.6e+02	12.2	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000008448

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000009757	0.818	Dachsous cadherin-related 1
2	9555.ENSPANP00000003640	0.719	Uncharacterized protein
3	9555.ENSPANP00000003733	0.687	FAT atypical cadherin 1
4	9555.ENSPANP00000009958	0.683	FAT atypical cadherin 3
5	9555.ENSPANP00000020510	0.622	annotation not available
6	9555.ENSPANP00000020511	0.617	annotation not available
7	9555.ENSPANP00000002233	0.554	Limb and CNS expressed 1 like
8	9555.ENSPANP00000007643	0.554	Limb and CNS expressed 1
9	9555.ENSPANP00000015453	0.543	Arginine-glutamic acid dipeptide (RE) repeats
10	9555.ENSPANP00000004867	0.527	Catenin beta 1
11	9555.ENSPANP00000008683	0.516	VANGL planar cell polarity protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046872	0.959	metal ion binding
GO:0005509	0.928	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.933	multicellular organismal process
GO:0009987	0.933	cellular process
GO:0048856	0.927	anatomical structure development
GO:0007275	0.915	multicellular organism development
GO:0048731	0.864	system development
GO:0048513	0.829	animal organ development
GO:0072001	0.617	renal system development
GO:0001822	0.606	kidney development
GO:0065007	0.426	biological regulation
GO:0050789	0.385	regulation of biological process
GO:0050794	0.303	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005886	0.976	plasma membrane
GO:0005622	0.912	intracellular anatomical structure
GO:0043226	0.887	organelle
GO:0043227	0.839	membrane-bounded organelle
GO:0043229	0.625	intracellular organelle
GO:0043231	0.580	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]